Details for Arabidopsis Locus AT1G26800

Position : Chr1 ( 5`- 9285099 .. 9286324 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26800

Protein [Map View]
MATEQEAEVGTETSSVSGRFLRNRDLYLFLPFLLGFSDQESSNGDDDDVASSRERIILVNPFTQGMIVLEGSSGMNPLLR
SLLESREEGRPPASKASIDAMPIVEIDGCEGECVICLEEWKSEETVKEMPCKHRFHGGCIEKWLGFHGSCPVCRYEMPVD
GDEIGKKRNDGNEIWVRFSFNDGRRIRDFSAQDGGNSDGVESEN*

DNA
ATGGCGACAGAACAAGAAGCTGAAGTTGGAACAGAGACATCCTCTGTTTCCGGAAGGTTTTTGAGGAACAGAGATTTATA
TCTCTTCTTGCCTTTTCTCTTAGGCTTCTCTGATCAAGAATCATCAAACGGAGATGATGATGATGTTGCTTCATCGCGTG
AGAGAATCATTTTAGTCAACCCTTTTACACAAGGAATGATTGTGCTCGAAGGCTCATCAGGAATGAATCCTCTGCTTCGT
AGCTTACTGGAGTCACGTGAGGAAGGTCGTCCTCCTGCGTCCAAGGCTTCCATCGATGCGATGCCGATCGTTGAGATTGA
TGGCTGTGAAGGAGAGTGTGTGATCTGTTTGGAGGAGTGGAAGTCCGAGGAGACGGTGAAGGAGATGCCGTGTAAGCATA
GGTTTCACGGTGGATGTATAGAGAAATGGTTAGGGTTTCATGGGTCGTGTCCTGTTTGTAGGTACGAGATGCCTGTTGAT
GGAGATGAGATTGGGAAGAAAAGAAACGATGGGAATGAGATTTGGGTTAGGTTCAGTTTCAACGATGGTCGGAGAATTAG
AGATTTTTCTGCGCAGGACGGTGGAAACAGTGATGGTGTTGAGTCCGAGAATTAG