Details for Arabidopsis Locus AT1G26780

Position : Chr1 ( 5`- 9271029 .. 9272463 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26780

Protein [Map View]
MFITEKQVWMDEIVARRASSSWDFPFNDINIHQHHHRHCNTSHEFEILKSPLGDVAVHEEESNNNNPNFSNSESGKKETT
DSGQSWSSSSSKPSVLGRGHWRPAEDVKLKELVSIYGPQNWNLIAEKLQGRSGKSCRLRWFNQLDPRINRRAFTEEEEER
LMQAHRLYGNKWAMIARLFPGRTDNSVKNHWHVVMARKYREHSSAYRRRKLMSNNPLKPHLTNNHHPNPNPNYHSFISTN
HYFAQPFPEFNLTHHLVNNAPITSDHNQLVLPFHCFQGYENNEPPMVVSMFGNQMMVGDNVGATSDALCNIPHIDPSNQE
KPEPNDAMHWIGMDAVDEEVFEKAKQQPHFFDFLGLGTA*

DNA
ATGTTTATAACGGAAAAACAAGTGTGGATGGATGAGATCGTCGCAAGAAGAGCTTCTTCTTCTTGGGACTTCCCTTTCAA
CGACATTAATATTCATCAGCATCATCATCGTCACTGCAACACAAGTCATGAGTTTGAAATCTTGAAGAGTCCTCTTGGAG
ATGTAGCGGTTCACGAAGAAGAGAGTAATAATAATAACCCTAATTTCAGTAACAGCGAGAGTGGTAAGAAGGAGACAACA
GATAGTGGTCAGTCTTGGTCCTCGTCGTCTTCAAAACCATCGGTCTTGGGGAGAGGACATTGGAGACCAGCTGAAGATGT
TAAACTCAAAGAGCTTGTCTCCATTTACGGCCCACAAAACTGGAACCTCATAGCTGAAAAGCTTCAAGGAAGATCTGGGA
AGAGCTGTAGACTACGATGGTTTAACCAATTGGACCCGAGGATAAACCGAAGAGCTTTCACAGAAGAAGAAGAGGAGAGG
CTGATGCAAGCACATAGGCTTTATGGTAACAAATGGGCAATGATTGCGAGGCTTTTCCCTGGTAGAACTGATAATTCAGT
GAAGAACCATTGGCATGTTGTCATGGCTCGTAAGTATAGAGAACACTCTTCTGCTTACCGTAGGAGAAAGCTTATGAGTA
ATAATCCACTTAAACCTCACCTCACCAATAATCATCATCCTAACCCTAACCCTAATTACCACTCTTTTATCTCCACTAAT
CATTACTTCGCTCAGCCTTTCCCCGAGTTTAATTTGACTCATCACCTGGTTAATAATGCCCCTATCACGAGTGACCATAA
CCAGCTTGTGTTGCCTTTCCATTGCTTTCAAGGTTATGAGAACAATGAACCTCCGATGGTTGTGAGTATGTTTGGCAACC
AAATGATGGTCGGCGATAACGTTGGTGCCACGTCAGACGCGTTATGCAATATTCCGCACATTGACCCTAGTAACCAAGAG
AAACCGGAGCCAAATGATGCAATGCATTGGATCGGAATGGACGCGGTAGATGAGGAGGTGTTCGAAAAGGCTAAGCAGCA
ACCACATTTTTTCGATTTTCTTGGCTTGGGGACGGCGTGA