Details for Arabidopsis Locus AT1G26770

Position : Chr1 ( 5`- 9259605 .. 9261313 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26770

Protein [Map View]
MCRLLTQDVNMGHLGFLVMIMVGVMASSVSGYGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFN
NGLSCGSCFEIRCENDGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVP
CRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSF
NAAPAGWSYGQTFAGGQFR*

DNA
ATGTGCAGGTTGTTAACACAAGACGTAAACATGGGTCATCTTGGGTTCTTAGTTATGATTATGGTAGGAGTCATGGCTTC
TTCTGTGAGCGGCTACGGTGGCGGTTGGATCAACGCTCACGCCACTTTTTACGGTGGTGGTGATGCTTCCGGCACAATGG
GTGGTGCTTGTGGATATGGTAATCTATATAGCCAAGGCTACGGGACGAGCACGGCGGCTCTAAGCACAGCTCTCTTCAAC
AATGGACTTAGCTGTGGTTCTTGCTTTGAGATAAGATGTGAAAACGATGGTAAATGGTGTTTACCTGGCTCAATCGTTGT
AACCGCTACAAACTTCTGCCCGCCAAATAACGCGTTAGCGAACAATAATGGCGGTTGGTGTAATCCTCCTCTTGAACACT
TTGACCTTGCTCAGCCTGTTTTTCAACGCATTGCTCAGTACAGAGCTGGAATCGTCCCTGTTTCCTACAGAAGGGTTCCT
TGCAGGAGAAGAGGAGGAATAAGATTCACGATAAACGGCCACTCATACTTCAACCTTGTGCTGATCACAAACGTCGGTGG
TGCCGGAGACGTTCACTCGGCGGCGATCAAGGGTTCAAGAACAGTGTGGCAAGCTATGTCAAGGAACTGGGGGCAAAATT
GGCAAAGCAACTCTTACCTCAACGGTCAAGCACTTTCCTTTAAGGTCACCACCAGCGACGGCCGCACAGTTGTCTCCTTC
AACGCCGCTCCTGCCGGCTGGTCTTATGGCCAGACTTTTGCCGGTGGACAGTTCCGTTAA