Details for Arabidopsis Locus AT1G26761

Position : Chr1 ( 5`- 9250224 .. 9251644 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26761

Protein [Map View]
MEATAVNPSIVTASRTVQPYRRLSTLSLRFPTYRNKRVSPFTLTITRCSTTKSREAGQDSSISLKRGLVFDLGVSKDSWH
SEEIGSPVVKRFLSDNEERWYMWYHGSSKQNPVSDSIGLAVSNNGIHWERGNGKVESSEDVGLVMSCGEDWWGFDTASVR
PGEVVIMSSSKVRANSSVYWMYYTGYTKETVEFQSQDFTSVLGNPERFHLCDENAEKSRVYYRSLPGLAISQDGRHWARI
EGEHHSGALFDVGSEKDWDFLYIASPHVVFHGDGDLRMYYHSFDEKTGEFCIGMARSRDGIKWLKLGKILGGRKSEKDGL
GFFDELGGRYPCVTRNKRDESYVMAYEGVDRTGKTSIGFAVSKDGIKDWKRVQDEEAVIAVGEGGAWDNEGVGCPYLIEM
DGDSDHQWRLYYRGVGNGGRTGIGLAVSQGNVITSFTKQTGIHL*

DNA
ATGGAAGCTACTGCTGTAAATCCCTCCATTGTCACTGCCTCGAGAACAGTTCAACCTTACAGGCGATTATCAACTCTCTC
ACTTCGATTCCCTACATACCGGAACAAACGTGTTTCTCCTTTCACGCTCACAATCACAAGATGTTCCACCACAAAAAGTA
GAGAAGCAGGTCAAGATTCATCGATCTCTTTGAAGAGAGGGCTAGTTTTTGATCTTGGCGTCTCTAAAGATTCGTGGCAC
AGTGAGGAGATTGGCTCTCCGGTTGTGAAGAGATTTCTAAGCGATAACGAAGAGAGATGGTACATGTGGTACCATGGAAG
CTCAAAGCAGAACCCTGTTTCTGATTCTATCGGATTAGCGGTTTCCAACAATGGGATTCATTGGGAAAGAGGAAATGGTA
AAGTTGAGTCAAGCGAAGATGTGGGTTTGGTTATGAGCTGTGGTGAAGACTGGTGGGGATTTGATACTGCAAGTGTTAGA
CCCGGTGAGGTTGTGATAATGTCGAGTTCTAAAGTCAGAGCTAATAGCTCTGTTTACTGGATGTATTACACTGGCTACAC
TAAGGAGACTGTTGAGTTTCAATCCCAAGATTTTACGTCCGTGTTGGGAAATCCGGAAAGGTTTCACCTTTGTGATGAGA
ATGCGGAGAAATCTAGGGTTTATTATAGGTCACTTCCAGGGTTAGCTATTAGTCAAGATGGTAGGCATTGGGCTAGAATT
GAAGGTGAGCATCATAGTGGGGCATTGTTTGATGTTGGGTCTGAAAAAGATTGGGACTTTCTCTATATTGCATCTCCACA
TGTAGTTTTCCATGGAGATGGCGATTTACGGATGTATTACCATTCATTCGATGAGAAAACCGGTGAATTCTGCATTGGGA
TGGCGAGGTCTAGAGATGGGATCAAGTGGTTAAAATTGGGAAAGATCTTAGGAGGAAGAAAATCCGAAAAGGATGGATTA
GGTTTCTTCGATGAGCTTGGAGGAAGATATCCTTGTGTGACAAGGAACAAGAGAGATGAGAGTTATGTGATGGCTTATGA
AGGTGTAGATAGAACCGGGAAGACGAGCATAGGCTTCGCGGTTTCGAAAGACGGGATTAAAGATTGGAAACGAGTGCAAG
ACGAGGAAGCGGTGATCGCGGTTGGTGAAGGCGGTGCGTGGGATAACGAAGGAGTTGGGTGTCCATATTTGATTGAGATG
GATGGAGATTCTGATCATCAATGGAGATTGTATTATAGAGGTGTTGGTAATGGTGGAAGAACAGGTATAGGCTTGGCTGT
TTCTCAAGGCAATGTGATCACTAGTTTTACAAAACAAACAGGGATTCACTTGTGA