Details for Arabidopsis Locus AT1G26750

Position : Chr1 ( 5`- 9246787 .. 9248274 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26750

Protein [Map View]
MSWMKGDLLSKTRRLVGGLATREPVWLKAMEASPPPVFPRSNGKIQKIVLPEDPYVRKFANKHPGTKIDDPAKISAFIPD
QARVYGCRVLELKEHGISEGDAMSVANMEYLSERKEMKKAYKRLKELAVMQDKDPPPKPYPSAKKGLITQSKTSAKDRFQ
TPSVRRLVNQLKNEKDVLLQDRTGGSANQDNWIDE*

DNA
ATGTCGTGGATGAAAGGTGATTTACTTTCCAAAACCAGGAGGCTTGTTGGTGGCTTAGCTACACGAGAGCCTGTTTGGCT
TAAAGCCATGGAAGCATCACCACCTCCTGTGTTTCCTCGCTCCAATGGAAAAATCCAGAAGATTGTTCTCCCTGAGGATC
CTTACGTTCGTAAATTCGCTAATAAGCATCCTGGAACCAAAATTGATGACCCTGCCAAGATATCAGCATTTATTCCAGAT
CAAGCACGTGTGTATGGTTGCCGGGTACTTGAATTGAAGGAGCATGGCATCAGTGAGGGTGACGCCATGTCTGTAGCTAA
TATGGAATATCTTTCAGAGAGAAAGGAAATGAAGAAAGCATACAAACGCTTAAAGGAGCTTGCGGTAATGCAAGATAAGG
ATCCACCTCCTAAACCGTATCCTAGTGCCAAGAAAGGGTTAATAACTCAATCGAAGACATCCGCTAAGGATCGCTTCCAG
ACTCCTAGCGTCCGCAGGCTAGTTAACCAGTTGAAAAATGAGAAAGATGTGTTGCTGCAAGACAGAACCGGAGGAAGTGC
TAATCAGGATAATTGGATCGACGAATAA