Details for Arabidopsis Locus AT1G26730

Position : Chr1 ( 5`- 9241435 .. 9244650 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26730

Protein [Map View]
MKFGKDFVRQMIPEWQQAYMDYAGLKSILQEIQTSRKRSERPGILKRKLSGSRNFSGLTKRYSRTASTREPEIQDILVHA
TTGDDGFERYETTILEVAEAGRESELAFFKTLDLEFDKVNHFYRSKVEEMVKEAVVLNKQMDALIAFRIKVERPSSSWSC
SETVSVDMNALDSNDQRNTLAEEMGIRVEGNGSNGGDSTKESVPQVLSVLERIRLNKTQETPLSTIKNVLKLSNQEELKF
TRENLKKIEERLKNVFIEFYRKLRHLKNYSFLNTLAISKIMKKYDKIASRSAAKPYMEMVDKSYLTSSDEINKLMLRVES
TFVEHFAGLNRSKGMNLLRPKVKKEKHRITFSTGFFVGCTVSLVVALVMFIHARNIMGAVGHKVYMETMFPLYSLFAFVV
LHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYRHVLLLSFGLGTLALCAVLINLDMEMDPNTNDYKTMTELLPMFILA
LVVAILFCPFNIFYRSSRVFFLMVVFRCIAAPLYKVNLPDFFLADQLTSQVQALRSLEFYICYYGWGDFKHRQNTCRSSD
VYSTFYFIVAVIPYWSRFLQCVRRLIEENDSSQGYNALKYLLTVVAVCLRTAYSFNRGNIWKISAWVFSALATFYGTYWD
IVFDWGLLHRPSKHLLREKLLVPHKAVYYVAIVLNIVLRMAWLQTVLDFNLSFLHRETMIALLAALEIIRRGIWNFFRLE
NEHLNNVGKFRAFKSVPLPFNYNEEEDRDS*

DNA
ATGAAGTTTGGGAAAGATTTTGTTAGGCAGATGATTCCAGAATGGCAACAAGCTTACATGGATTATGCTGGTCTCAAATC
TATTCTTCAAGAAATCCAAACTTCACGGAAAAGATCAGAGAGACCAGGTATCTTGAAACGCAAGCTATCTGGTAGCCGCA
ACTTCAGCGGCCTGACAAAGCGGTATAGCCGCACCGCCTCGACTCGGGAACCAGAAATTCAGGACATTCTGGTGCACGCA
ACTACTGGGGATGATGGGTTTGAGAGATACGAGACAACCATCTTGGAAGTTGCAGAGGCGGGGAGAGAGTCAGAGCTTGC
GTTCTTTAAAACCCTAGATCTTGAATTCGATAAAGTTAACCATTTTTACCGGTCTAAAGTGGAGGAAATGGTGAAGGAGG
CAGTGGTTTTGAACAAACAAATGGATGCTCTCATTGCTTTCAGAATCAAAGTTGAGCGACCTTCTTCTTCGTGGAGCTGC
TCTGAAACAGTTTCAGTGGATATGAATGCCTTAGATTCTAATGACCAGAGGAATACATTAGCTGAGGAGATGGGAATCAG
AGTAGAGGGAAATGGATCCAACGGTGGAGATTCAACGAAAGAGAGTGTACCACAAGTGTTAAGTGTTCTTGAACGTATCA
GATTAAACAAAACTCAGGAAACTCCTCTCTCCACAATTAAAAACGTCCTCAAGCTCTCTAACCAAGAAGAGCTCAAATTC
ACTAGAGAGAATCTCAAGAAAATAGAAGAACGGCTTAAGAATGTCTTCATCGAGTTTTATCGCAAGCTTCGACATCTCAA
GAATTACAGCTTCTTGAACACTTTGGCTATTTCCAAGATCATGAAAAAGTATGATAAGATTGCTTCAAGAAGTGCAGCAA
AACCATACATGGAGATGGTTGATAAGTCCTACCTCACTAGCTCTGATGAGATCAACAAGCTTATGTTGAGAGTTGAGTCA
ACCTTCGTTGAACATTTCGCCGGTTTGAATCGAAGCAAAGGAATGAATCTCTTAAGACCAAAAGTAAAGAAAGAAAAACA
TCGAATAACGTTTTCCACTGGCTTTTTCGTCGGTTGCACAGTCTCTCTAGTGGTAGCTCTAGTCATGTTTATCCATGCTC
GTAATATAATGGGCGCAGTTGGACATAAAGTCTACATGGAGACAATGTTCCCTCTTTACAGTTTATTTGCATTTGTGGTT
CTGCATATGATCATGTATGCTTCAAACATATACTTTTGGAAGCGATATCGAGTGAATTATCCGTTTATATTCGGTTTTAA
AGAAGGAACAGAGCTTGGTTATAGACATGTTCTGCTTCTAAGCTTTGGTCTCGGCACGCTTGCTCTCTGCGCTGTTCTAA
TAAACCTTGACATGGAGATGGATCCTAACACTAATGACTACAAAACCATGACTGAACTTCTTCCCATGTTTATTTTGGCT
CTAGTGGTAGCTATTTTGTTCTGTCCTTTCAACATCTTTTATCGGTCAAGCCGCGTCTTCTTCCTCATGGTTGTCTTCCG
CTGCATTGCTGCGCCACTCTACAAGGTTAATCTTCCAGATTTTTTCTTGGCAGACCAATTAACAAGTCAGGTTCAAGCAC
TAAGGAGTTTGGAGTTTTACATATGTTACTATGGTTGGGGAGACTTCAAGCACAGGCAAAATACTTGCAGATCAAGCGAT
GTATACAGTACATTCTACTTCATCGTTGCTGTGATACCTTACTGGTCACGTTTTCTTCAGTGTGTTCGAAGATTGATCGA
AGAGAATGATTCAAGTCAAGGCTACAATGCTCTCAAGTATTTATTAACCGTTGTGGCTGTTTGCTTGAGAACAGCTTACA
GCTTTAACAGAGGAAACATCTGGAAAATCTCTGCCTGGGTTTTCTCGGCATTGGCAACTTTTTACGGCACATATTGGGAC
ATTGTTTTTGATTGGGGATTACTTCACAGACCATCTAAACATTTGTTGAGAGAGAAGCTTCTTGTTCCTCACAAAGCCGT
CTACTACGTTGCAATCGTCTTAAACATTGTGTTGAGGATGGCGTGGTTGCAGACTGTGCTTGATTTCAATTTATCGTTCT
TACATCGAGAAACGATGATTGCTCTTCTTGCTGCTCTTGAGATCATACGTCGTGGTATCTGGAATTTCTTCAGGTTGGAG
AATGAACACTTGAACAATGTGGGAAAGTTCAGAGCATTCAAATCAGTTCCGTTACCATTCAACTACAACGAGGAGGAAGA
TCGAGATAGTTAA