Details for Arabidopsis Locus AT1G26690

Position : Chr1 ( 5`- 9224145 .. 9225775 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26690

Protein [Map View]
MFLRSLNLCTILLFLAISSQVSQSLHFELQSGRTKCISEDIKSNSMTVGKYTVVNPNEAHPSPQSHKISIRVTSSYGNTY
HHAEDVESGQFAFTAVESGDYMACYTAVDHKPEVTLSIDFDWRTGVQSKSWSSVAKKSQVEVMEFDVKRLIETVNSIHEE
MFYLREREEEMQNLNRATNSKMAWLSFLSLFVCLGVAGMQFVHLKTFFEKKKVI*

DNA
ATGTTTCTCCGATCACTCAATCTCTGTACAATACTACTCTTCCTAGCGATTTCATCACAAGTTTCTCAATCTCTCCACTT
CGAATTGCAATCTGGTCGAACAAAATGTATATCGGAAGACATAAAAAGCAATTCAATGACCGTCGGGAAGTACACCGTCG
TTAACCCTAACGAAGCTCATCCTTCTCCTCAATCTCACAAGATCTCCATCAGAGTGACATCGAGTTACGGGAACACGTAT
CATCACGCGGAAGATGTAGAATCGGGACAATTCGCGTTCACGGCGGTGGAGTCTGGAGATTACATGGCTTGTTACACAGC
TGTTGATCATAAACCTGAGGTTACATTGAGTATTGATTTCGATTGGAGAACTGGTGTTCAATCTAAAAGCTGGAGTAGTG
TTGCTAAGAAGAGCCAAGTCGAAGTTATGGAGTTTGATGTAAAAAGACTTATTGAAACCGTCAATTCGATTCATGAAGAG
ATGTTTTATCTCAGAGAAAGGGAAGAAGAGATGCAGAATCTGAACCGGGCTACTAACTCGAAAATGGCGTGGTTGAGTTT
CCTCTCTCTTTTCGTATGCTTAGGAGTCGCGGGAATGCAGTTTGTGCATTTGAAGACGTTTTTCGAGAAGAAGAAAGTCA
TCTAA