Details for Arabidopsis Locus AT1G26680

Position : Chr1 ( 5`- 9219463 .. 9223649 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26680

Protein [Map View]
MADQSLLHSPINPHFFQPILTESRTHLNIPVAFFSKHVEGRNNQNKTVTLRSDASDKTWLVKMDGLKLTDGWEDFAFAHD
LRTGDIVVFRLEGEMVFHVTALGPSCCEIQYHTSSHNINDDDRNDQINIASRNSSRVKKNPRKKVESSLDHSRFVAKVSA
WCLSNDRLYIPLSFARLNGLNKINSKKIYLQNEEGRSWKLVLRHDKSGMQTFVQSGWRRFCSENGIRQGQYTFKLVRKSA
PPVIRLCRAKAKPKQRSVAEYSSDHSCFEGSVTPSSLRNDLLYLPRSFVNSNRLDKRCSEIVLKNEQGVKWPLVLKRFKS
VTYLPKGWTSFCQVNRIKAGDSFKFKLVGTWKKPVLSLCPTQSNNHKTPLECSEGNKSEESEEDCLEVKKKKYWSRCRAS
VENMDDDQTNIGNSSRKKRVSKNPREKVESSSDHSSFVGSVNPSSLYKDQLYLPRNFVSSNFLDKRCSEIVLKNERGEKR
TLVLKHFKKDLTFLKKGWTSFCQVNRIKAGDSFKFKLVGTWNKPVLSLCPTETNYHKTPLACSEGNKSEESEEEGTEDKN
TSQDCLEVKKRKYWSTCRASAENIDDDQTNIGNSSKEKRVKKNPVKKAESSSDHSSFVANVTASSLNYDRLYLPLSFVSS
NGLDKMNGKEIVLLNEEGLSWKFNLKYNQAGKHTYVRPGWSRFCDANGMSQGQQFTFKLVQKHGPPVMYLSLSEHRPKSE
SSSHRSYFVGSVTASSIKKDKLYLWKSFVSSNGLDKGCKKIILKNKWGREWKLVLKHYKSNCFTIIKRGWTSFCQGNGLK
AGDSFKFKLVGTGEKPVLSLCPAESSHEKIPLECPEGIDDVNSLSSNPSSGDDSSRSEESEEENMEDKNISQDCLETKKR
KYCSSSSYSQNRFVTLTLTRSAFQTYKLVSFFNNYASRLS*

DNA
ATGGCGGATCAATCTCTTCTACACTCTCCGATCAACCCACATTTCTTTCAGCCTATTCTTACAGAATCTCGCACTCACCT
CAACATTCCTGTAGCTTTCTTCTCGAAGCATGTTGAAGGAAGAAACAACCAAAACAAGACTGTGACGCTAAGATCAGACG
CGTCGGATAAAACTTGGTTAGTGAAGATGGACGGTCTAAAACTAACCGACGGATGGGAAGATTTTGCCTTTGCACATGAT
CTTCGAACTGGTGACATCGTCGTTTTCAGACTTGAAGGAGAAATGGTGTTTCATGTCACAGCTTTAGGACCAAGCTGTTG
CGAGATTCAATATCATACATCATCTCACAATATCAATGATGATGATCGTAATGATCAGATCAACATTGCTTCAAGAAACA
GTTCAAGAGTGAAGAAGAATCCACGAAAGAAAGTAGAGTCTTCTTTAGACCATTCTCGTTTTGTGGCAAAAGTCTCAGCT
TGGTGCCTAAGCAATGATAGACTGTATATACCACTAAGTTTCGCCAGGTTAAACGGTCTGAACAAAATCAACAGTAAGAA
AATCTATCTTCAGAACGAAGAAGGAAGATCATGGAAGTTAGTTTTGAGACATGACAAATCAGGCATGCAAACTTTTGTCC
AATCCGGTTGGAGAAGATTCTGCTCTGAAAATGGGATTAGGCAAGGTCAATATACATTCAAACTTGTCCGAAAATCAGCA
CCACCTGTCATCCGTTTGTGCCGCGCAAAAGCTAAACCAAAACAAAGATCAGTTGCAGAATATTCATCAGACCATTCTTG
TTTTGAGGGATCTGTCACTCCTTCAAGCCTAAGAAATGATCTACTGTATCTTCCAAGGAGCTTTGTGAACTCAAATCGTC
TGGACAAAAGATGCAGTGAGATAGTTTTAAAGAATGAACAGGGAGTAAAATGGCCTTTAGTTTTGAAACGTTTCAAATCA
GTCACTTATCTCCCAAAAGGCTGGACTAGTTTCTGTCAAGTAAACAGGATCAAAGCAGGAGATTCATTCAAGTTTAAACT
GGTTGGAACCTGGAAAAAACCTGTTCTTTCTTTGTGTCCGACACAATCCAACAATCACAAAACTCCATTAGAGTGTTCAG
AAGGTAACAAATCCGAAGAAAGTGAAGAGGATTGCTTGGAGGTAAAGAAAAAGAAGTATTGGTCGAGATGCAGAGCTTCT
GTAGAAAACATGGATGATGATCAGACCAACATTGGAAACAGTTCAAGAAAGAAGAGAGTGAGTAAGAATCCAAGAGAGAA
AGTAGAGTCTTCATCAGACCATTCTAGTTTTGTGGGATCTGTCAATCCTTCAAGCCTATACAAAGATCAACTGTATCTTC
CAAGGAATTTTGTGAGCTCAAATTTTCTGGACAAAAGATGCAGTGAGATAGTTTTAAAGAATGAACGGGGAGAAAAAAGG
ACTTTAGTTTTGAAACACTTCAAAAAAGACCTTACTTTTCTCAAAAAAGGCTGGACTAGTTTCTGTCAAGTAAATAGGAT
CAAAGCTGGAGATTCCTTCAAGTTTAAACTGGTTGGAACATGGAACAAACCTGTTCTTTCTTTGTGCCCTACAGAAACCA
ACTATCACAAAACTCCATTAGCGTGTTCAGAGGGTAACAAATCCGAAGAAAGTGAAGAGGAGGGTACTGAAGACAAGAAT
ACCTCACAAGATTGCTTGGAGGTGAAGAAAAGGAAGTATTGGTCAACATGCAGAGCTTCTGCAGAGAACATAGATGATGA
TCAGACCAATATTGGAAACAGTTCAAAAGAGAAGAGAGTGAAGAAAAATCCAGTAAAGAAAGCAGAGTCTTCATCAGACC
ATTCTAGTTTTGTGGCTAATGTCACAGCTTCAAGCCTAAACTATGATCGACTGTATTTACCACTAAGTTTCGTGAGTTCA
AACGGTCTAGATAAAATGAACGGTAAGGAGATCGTTCTTCTTAATGAAGAAGGACTATCATGGAAGTTTAATTTGAAGTA
CAACCAAGCAGGCAAGCATACTTATGTCAGACCTGGTTGGTCAAGATTCTGTGATGCAAATGGGATGAGCCAAGGTCAAC
AATTTACATTCAAACTGGTCCAAAAACATGGACCACCTGTCATGTATTTGAGCCTCAGTGAACATAGACCAAAGTCAGAA
TCTTCATCGCACCGTTCCTATTTTGTAGGATCTGTCACTGCTTCAAGCATAAAGAAAGATAAACTGTATTTATGGAAGAG
TTTTGTGAGCTCTAATGGTCTGGACAAAGGATGCAAGAAGATAATTTTAAAGAATAAATGGGGAAGAGAATGGAAATTAG
TCTTGAAACACTACAAATCAAACTGCTTTACTATTATCAAACGAGGCTGGACCAGTTTCTGCCAAGGCAACGGTTTGAAA
GCTGGAGATTCCTTCAAGTTCAAACTGGTTGGAACCGGGGAAAAGCCTGTTCTTTCTTTGTGCCCTGCAGAATCCAGCCA
TGAAAAAATTCCATTAGAGTGTCCAGAAGGTATAGATGATGTCAATTCACTCTCCTCAAATCCTAGCAGTGGAGATGACA
GTAGTAGATCCGAAGAAAGCGAAGAGGAGAATATGGAAGACAAGAACATCTCACAGGATTGCTTGGAAACCAAGAAAAGG
AAGTATTGCTCTTCATCGTCATATAGTCAAAACCGATTTGTGACATTAACTCTTACACGGTCCGCTTTTCAAACCTATAA
ACTGGTAAGCTTCTTCAACAACTATGCCTCAAGGTTGTCTTAG