Details for Arabidopsis Locus AT1G26665

Position : Chr1 ( 5`- 9214174 .. 9215552 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26665

Protein [Map View]
MDPTQNTSAGIGGSNGTIRYQTNDGTSTVTVADDSKENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVM
ELDNMTKLSEKCNIQIPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVDMYREI
RASSAAEAKRLAQSQSVLPNGDAKVKNEL*

DNA
ATGGATCCAACACAGAACACAAGTGCAGGGATTGGTGGGAGCAATGGTACAATCAGATATCAAACCAATGATGGGACTTC
AACTGTGACCGTTGCTGATGATTCAAAGGAGAATCTTTCCCAAGTCATAAACTCTATTGAGAAAACTTTAGGAGTCCTTC
ATCAGTTACACCTTACCGTCACTTCTTTCACACCCGCGTCTCAACTCCATCTCCTCCAGCGCCTTAACTCTCTTGTGATG
GAGCTAGATAACATGACTAAGTTGTCTGAGAAATGCAACATTCAAATCCCCATGGAGGTTCTTAACTTGATTGATGATGG
GAAGAACCCGGATGAGTTTACGAAAGATGTTCTTAATAGCTGCATAGCTAGAAATCAAGTTACTAAGGGCAAGACTGATG
CTTTTAAGGATTTGAGAAAACATATTCTGGAGGAGCTTGAACAGAATTTCCCTGATGAAGTCGATATGTATAGAGAAATC
CGTGCTAGTTCTGCTGCTGAAGCGAAACGGTTGGCGCAATCGCAAAGTGTGTTACCAAATGGGGATGCAAAGGTCAAGAA
TGAGCTATAA