Details for Arabidopsis Locus AT1G26660

Position : Chr1 ( 5`- 9211740 .. 9213974 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26660

Protein [Map View]
MEEGRQKDLQLLEEIIDKGLKQKLVHATASRFRFIVVSAFVGFAGTRSLKNKKHCILLYREDSSFSSDLRKNLETLEKNG
VNSLKTRVNLGSEVYMQAEVPDTRHIFMDVGLGFYVEFTRQEALDYIAQREERTQKQLEEYTGVITQIKGRIKLAHYQIQ
QILNLPEENPSSRQRAF*

DNA
ATGGAGGAGGGACGTCAAAAAGACTTGCAATTGTTGGAGGAGATTATCGACAAAGGTTTGAAACAGAAGCTTGTACATGC
AACTGCTTCACGGTTTCGATTCATTGTGGTCTCTGCATTTGTTGGTTTTGCAGGGACAAGATCTTTGAAGAACAAAAAAC
ACTGTATCCTTTTGTATAGGGAAGACTCTAGCTTCTCCTCTGACTTGCGGAAAAACCTAGAAACTCTGGAGAAGAATGGT
GTAAATAGTCTCAAAACAAGGGTCAACCTTGGTTCAGAAGTTTACATGCAAGCTGAAGTGCCAGATACTCGGCACATATT
CATGGATGTAGGCCTCGGCTTTTATGTGGAGTTCACACGGCAAGAAGCTCTTGACTATATAGCACAAAGGGAGGAAAGAA
CTCAAAAACAACTAGAAGAGTATACTGGTGTTATTACGCAGATCAAAGGGCGCATCAAACTGGCTCATTACCAGATTCAG
CAAATACTCAATCTTCCTGAAGAGAATCCGTCATCCCGGCAACGTGCGTTTTAG