Details for Arabidopsis Locus AT1G26650

Position : Chr1 ( 5`- 9210089 .. 9211560 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26650

Protein [Map View]
METETNQVLRKPELKSYSHKQFHSSNALEILRETVRILRYNLGALMLTTAVLICPVSALLLPNFLVDQSLVNKLTVKLLL
VAKSSGLPLQPFVKHSCQKFAETAVSSAMCFPVFITVSLLSKAAVVYSVDCSYSREVVDISKFLVILQKIWRRVVFTYVW
ICILIVGCFTFFCVLLVAICSSFSVLGFSPDFNVYGAMLVGLAFSVVFANAIIICNTAIVISVLEDVSGLGALMRASDLI
KGQIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGSSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCRVYYSMEASRG
ETQPIMETVTVVDAE*

DNA
ATGGAGACGGAAACGAATCAGGTTTTACGGAAACCGGAGCTAAAATCATACAGTCACAAACAATTTCACTCCTCAAATGC
GTTAGAGATCTTAAGAGAAACAGTTCGAATTCTCCGGTACAATCTTGGTGCTTTAATGTTAACTACTGCTGTTTTGATCT
GTCCTGTCTCTGCTTTGCTCTTACCAAACTTTTTAGTTGATCAATCATTAGTGAATAAACTCACAGTGAAGCTTCTTTTA
GTGGCGAAATCAAGTGGTCTTCCTTTGCAGCCTTTTGTCAAACATTCTTGTCAGAAATTCGCTGAAACTGCTGTTTCGTC
TGCAATGTGTTTCCCTGTGTTTATCACTGTGTCTCTGTTGTCTAAAGCAGCTGTGGTTTACTCAGTGGATTGTTCTTACT
CGAGGGAAGTAGTTGATATAAGCAAGTTCTTGGTTATATTGCAGAAGATATGGAGGAGAGTTGTGTTCACTTACGTTTGG
ATTTGCATTCTGATTGTTGGTTGCTTCACTTTCTTTTGCGTTCTTCTTGTAGCAATCTGCAGTTCCTTCTCTGTTCTCGG
CTTCTCTCCAGATTTCAATGTTTATGGAGCTATGCTAGTTGGTTTAGCCTTCTCTGTAGTTTTCGCTAACGCGATTATAA
TCTGCAACACTGCGATTGTGATCTCGGTTTTGGAAGATGTTTCAGGGTTAGGAGCATTGATGAGAGCTAGTGATTTGATC
AAAGGGCAGATTCAGGTTGGTTTGTTGATGTTCCTTGGATCAACTTTAGGATTGGCGTTTGTGGAAGGATTGTTTGATCA
CAGAGTGAAGAAAGTTAGTTATGGAGATGGCTCTTCGAGGTTATGGGAAGGACCTCTTTTGGTGTTGATGTATTCCTTTG
TGACACTTATAGATTCGATGATGAGTGCAGTGTTCTATTTTAGCTGCCGAGTTTATTATAGTATGGAAGCTTCTAGAGGT
GAAACTCAGCCAATCATGGAAACGGTTACGGTTGTGGATGCTGAGTAA