Details for Arabidopsis Locus AT1G26640

Position : Chr1 ( 5`- 9207388 .. 9209902 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26640

Protein [Map View]
MELNISESRSRSIRCIVKLGGAAITCKNELEKIHDENLEVVACQLRQAMLEGSAPSKVIGMDWSKRPGSSEISCDVDDIG
DQKSSEFSKFVVVHGAGSFGHFQASRSGVHKGGLEKPIVKAGFVATRISVTNLNLEIVRALAREGIPTIGMSPFSCGWST
SKRDVASADLATVAKTIDSGFVPVLHGDAVLDNILGCTILSGDVIIRHLADHLKPEYVVFLTDVLGVYDRPPSPSEPDAV
LLKEIAVGEDGSWKVVNPLLEHTDKKVDYSVAAHDTTGGMETKISEAAMIAKLGVDVYIVKAATTHSQRALNGDLRDSVP
EDWLGTIIRFSK*

DNA
ATGGAGCTGAATATTTCCGAGAGTCGAAGCAGATCAATTCGTTGCATTGTGAAACTTGGAGGTGCGGCAATTACTTGCAA
AAACGAGCTGGAGAAGATTCACGATGAAAATCTGGAGGTCGTGGCGTGTCAGTTACGTCAAGCTATGTTGGAGGGTTCAG
CTCCAAGCAAGGTTATTGGCATGGATTGGAGCAAGAGACCTGGAAGCTCTGAGATTTCTTGTGATGTGGATGACATAGGG
GATCAAAAGTCTTCTGAGTTTAGTAAATTTGTTGTGGTTCATGGCGCTGGTTCCTTTGGGCACTTTCAGGCCAGTAGATC
TGGGGTTCACAAAGGAGGACTTGAGAAACCTATTGTCAAAGCTGGTTTCGTTGCTACTCGTATATCTGTGACAAATCTTA
ATCTTGAAATTGTACGAGCACTAGCCCGAGAGGGCATTCCTACGATAGGCATGTCTCCATTTTCATGTGGTTGGTCAACC
TCCAAAAGAGATGTGGCTTCTGCAGATCTAGCAACCGTAGCTAAAACCATAGACTCAGGATTTGTCCCTGTTCTCCATGG
AGATGCAGTGCTGGACAATATACTGGGCTGCACCATATTGAGTGGTGATGTTATCATCCGTCATCTTGCAGATCATTTGA
AGCCAGAATATGTTGTCTTTCTCACAGATGTACTAGGTGTCTACGATCGACCACCTTCACCTTCAGAGCCCGACGCTGTG
CTCTTGAAAGAGATCGCTGTTGGAGAAGATGGAAGCTGGAAGGTTGTGAATCCACTGTTGGAGCACACAGACAAGAAAGT
TGACTACTCTGTTGCGGCGCACGATACAACCGGTGGAATGGAAACGAAGATATCAGAAGCTGCTATGATTGCAAAACTTG
GAGTCGATGTCTACATTGTGAAGGCTGCGACAACTCATTCACAGAGAGCACTAAACGGTGATTTGAGAGATAGTGTTCCT
GAAGATTGGCTTGGTACTATCATCAGATTCTCAAAGTAG