Details for Arabidopsis Locus AT1G26620

Position : Chr1 ( 5`- 9195838 .. 9199669 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26620

Protein [Map View]
MRDAADSSSYSGYEKDFMKHTMLEHEAVFKNQVHELHRLYRVQKNLVEEVKGKNLNEVMNVSDHHTSENESKRKLHGFLL
PNSTCGEGSSTQASNGRLQNGGSSNGDASEGRDVKGRRRMIDLQLPADEYLDTDETTNTGENTSFPPYNQLKSGRGDASH
RSYPSGSCLDVKNSNGLADLNEPLKGQDSEPAALSRDMYSHYGRNNAHVQGQWLEKNRTQNGWMVLEAGQDRSTQRDQVH
LPSHSGQVLSNNAFQPQSYPTTDHSKVKFSGERAHRELEVRSKTPQVSYDSYVESSVASTAPRSVNDYRPEFFKPLTHWS
SSGRTMTSSNQKSYPVQTNPYMNFDTHARPDLSFENRSHVSNGLYQGFSSGSKQSFYNFPSTGFKPNASIGEVANSHSFV
NLQGPKRQECSAGLPWLKPQPPYRSGMSNGFFDLNASTNQFMDGTDAGDDLTCASVLKGLRSASYSNNANMGRVETNNSQ
SSTKIIGSPIFGKQFVCKQERTPLIPHSLWIANQHKEVNHLVKRDLDINLPCDASVSVDQHGAKAYYVDKKEGKKAANFR
HYIDLNSCANEDDEDSGFLSSLSVKTKARTWIDLEAPPTLESEEEGDNSQDKTNEETWRMMQGQDGNSMNELIKVAAEAI
VAISMAGHQRHPDDAASSSTDAASKSPLSWFAEIITSCGDELERKIDGSPEATDFEGNREDYSSGEIDYFEAMTLNIQET
KEEDYMPEPLVPENLKFEDTCINKPRRGQARRGRPKRDFQRDTLPGLSSLSRHEVTEDIQMFGGLMKTGDYTWSSGLAVR
RNSKRKRNVTNINQAPLCPSMAQPMNESVSVGGLEDSKLSGWGQATRRPRRQRCPPAGSNPPTVILT*

DNA
ATGAGAGATGCAGCGGATTCGTCATCATACTCTGGATACGAGAAAGATTTCATGAAACATACAATGCTTGAGCACGAAGC
TGTTTTCAAGAATCAGGTGCATGAGCTTCACCGTTTGTATAGAGTACAGAAGAATTTGGTTGAGGAAGTAAAAGGAAAGA
ACTTGAATGAAGTTATGAACGTGAGTGATCATCATACATCTGAAAATGAAAGTAAGAGGAAGTTACATGGGTTTCTTTTA
CCAAACTCAACATGTGGAGAAGGGAGCAGCACACAAGCGTCCAACGGTCGTTTGCAAAATGGTGGTAGTTCAAATGGGGA
CGCGTCCGAGGGTAGAGATGTGAAGGGGAGGAGAAGAATGATTGATCTTCAACTTCCAGCCGATGAGTATCTTGATACTG
ATGAAACTACTAACACCGGTGAGAATACAAGCTTCCCTCCATACAACCAGTTAAAATCAGGAAGAGGGGATGCTTCTCAT
CGGAGCTATCCTTCAGGATCTTGCTTGGATGTGAAGAACTCAAATGGCTTAGCTGACTTGAATGAGCCACTCAAAGGGCA
AGATTCAGAACCTGCTGCTCTGTCTAGGGATATGTATTCTCATTATGGGAGAAACAATGCTCATGTTCAAGGTCAGTGGT
TGGAGAAAAATCGAACTCAAAATGGATGGATGGTCCTTGAAGCAGGGCAAGATAGGAGCACTCAGAGAGATCAGGTGCAT
CTGCCTTCTCATTCAGGACAAGTACTTTCTAACAATGCATTTCAACCTCAGAGCTATCCTACAACTGATCACAGCAAGGT
CAAATTTTCCGGGGAAAGAGCACATCGTGAGCTAGAAGTTCGCTCAAAGACTCCTCAAGTTTCTTATGATAGCTACGTTG
AATCAAGTGTGGCATCTACTGCTCCAAGATCAGTCAATGACTACCGCCCTGAATTTTTCAAACCATTGACCCATTGGTCT
TCATCCGGGAGGACTATGACCAGCTCAAATCAGAAATCTTATCCAGTTCAAACGAATCCCTACATGAATTTTGACACACA
TGCAAGACCAGATTTGAGTTTTGAGAATAGAAGCCATGTCTCTAATGGGCTTTATCAAGGATTCTCTTCAGGGTCAAAGC
AGTCTTTCTATAATTTCCCATCAACCGGCTTTAAACCAAATGCTTCCATAGGCGAGGTAGCGAACAGCCACAGTTTTGTA
AATCTTCAAGGGCCAAAAAGGCAGGAATGCTCAGCTGGGTTGCCCTGGCTAAAACCTCAGCCCCCTTACAGAAGTGGAAT
GTCCAATGGCTTCTTTGATCTGAATGCTTCGACAAATCAATTCATGGATGGAACTGACGCTGGGGACGACTTGACTTGTG
CTTCTGTTCTGAAGGGTTTGCGATCTGCTTCATACTCTAATAATGCAAACATGGGAAGAGTTGAAACGAACAACTCTCAG
AGTAGTACTAAAATTATTGGGAGCCCAATCTTTGGGAAGCAATTTGTTTGCAAGCAGGAGCGTACGCCCCTTATCCCTCA
TTCCTTATGGATTGCTAATCAACACAAGGAAGTAAATCACTTGGTAAAGCGAGACCTTGATATCAACCTGCCATGTGATG
CCTCGGTTTCTGTTGACCAGCATGGTGCTAAAGCCTACTATGTAGACAAGAAAGAAGGGAAAAAAGCTGCCAACTTCAGA
CACTACATTGATCTGAATTCATGTGCTAATGAGGATGACGAAGATTCCGGCTTCCTTTCCAGTCTGAGTGTGAAAACAAA
AGCAAGAACTTGGATAGATTTGGAAGCTCCCCCTACTCTCGAGAGTGAAGAAGAAGGAGATAACTCACAGGACAAAACAA
ATGAAGAAACTTGGAGAATGATGCAAGGCCAAGACGGAAACTCTATGAATGAACTCATCAAGGTAGCAGCAGAAGCAATA
GTTGCCATCTCAATGGCTGGTCACCAACGCCATCCTGATGACGCAGCTTCCTCTTCAACTGATGCGGCTTCAAAAAGCCC
GCTCTCTTGGTTTGCAGAAATAATCACTTCTTGCGGTGATGAGTTAGAAAGAAAGATTGATGGTTCTCCAGAAGCCACAG
ACTTTGAAGGTAACAGGGAAGACTATTCTTCTGGGGAGATTGATTACTTTGAAGCCATGACCCTGAATATACAGGAGACA
AAGGAGGAAGACTACATGCCAGAGCCATTAGTCCCAGAGAATCTGAAATTCGAAGATACATGTATTAACAAGCCAAGAAG
AGGACAAGCAAGACGAGGAAGACCAAAGCGGGATTTCCAAAGGGATACTCTACCTGGTCTCTCTTCTCTGTCGAGGCATG
AAGTCACTGAAGATATCCAAATGTTTGGGGGACTGATGAAAACCGGAGACTACACTTGGAGTTCTGGATTGGCTGTTCGA
CGGAACTCAAAAAGAAAACGAAATGTCACTAACATAAACCAAGCTCCATTATGCCCGTCAATGGCGCAGCCAATGAATGA
GAGCGTATCAGTGGGAGGACTTGAAGACAGTAAGCTCTCAGGATGGGGACAAGCAACAAGAAGACCGAGGAGACAAAGGT
GCCCTCCTGCAGGTAGTAATCCCCCAACCGTGATCTTAACATAA