Details for Arabidopsis Locus AT1G26600

Position : Chr1 ( 5`- 9191607 .. 9192401 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26600

Protein [Map View]
MTMTHLNRLILISLLFVSLLLKSSTASSTVVDEGNRTSRNFRYRTHRFVPRFNHHPYHVTPHRSCDSFIRPYARSMCIEL
QRIHRSSRKQPLLSPPPPEIDPRYGVDKRLVPSGPNPLHN*

DNA
ATGACGATGACTCACCTGAATCGTCTGATCTTGATCTCTCTTCTCTTCGTCTCTTTACTTCTCAAATCCTCCACCGCTTC
TTCAACCGTCGTCGACGAAGGAAACAGAACATCAAGAAACTTCCGTTACCGAACGCACCGATTCGTTCCGAGGTTTAACC
ACCACCCTTACCACGTGACTCCTCACCGTTCGTGTGATTCCTTCATTCGTCCTTACGCGCGTTCTATGTGCATTGAGCTT
CAGAGAATCCACCGTAGCAGTCGGAAGCAGCCACTTCTTTCTCCTCCTCCTCCGGAGATTGATCCAAGGTACGGCGTCGA
CAAAAGACTCGTCCCCTCTGGTCCAAACCCGCTTCACAACTAA