Details for Arabidopsis Locus AT1G26590

Position : Chr1 ( 5`- 9189624 .. 9190709 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26590

Protein [Map View]
MEEGKENSFLCKYCYKTFPSGKALGGHIRIHTNENSVGYNGNKKKRLVDQRKMMAQKHKQQQQVGCRECGRVFVSLKALR
GHMACHGEVKKMLMDDNSQSDTESETSSAPMRKRSKRVVMKQSNSESLSNGSSSFGSEIDQERRDGAYNLMMLSSDSSSF
KKRRNMVMNSLGESSDNNSAIVENKSSSGDEFKIMNVKNAVDDQWRSADDDGVSLCDSDGSDSDYFMNGPSKSESDISVD
RNTGFGSGFNNSLIRFRNSNEGGTKYELSKSKRALFSYETDSCADTNSKIHHRFKDSKSSMVKKEGGEKVKSKGHECPIC
FRMFKSGQALGGHKRSHSIANHAAEMRNQIDLYLPVSDTDE*

DNA
ATGGAGGAAGGGAAAGAGAATTCGTTTTTGTGCAAGTACTGTTACAAGACGTTTCCTTCTGGGAAAGCACTCGGTGGTCA
CATTAGAATTCATACGAACGAGAATTCAGTTGGTTACAATGGCAATAAGAAGAAGAGGTTGGTGGATCAGAGAAAGATGA
TGGCTCAGAAACATAAGCAACAACAACAAGTTGGTTGCAGAGAATGTGGTAGAGTGTTCGTTTCTTTGAAAGCTCTTAGA
GGTCACATGGCTTGTCACGGTGAGGTAAAGAAGATGTTGATGGATGATAATAGCCAATCTGATACTGAAAGTGAGACTTC
CTCAGCTCCTATGAGGAAAAGATCCAAGAGGGTGGTCATGAAACAATCAAATTCTGAATCTTTGAGTAATGGGAGCTCGT
CTTTTGGTTCTGAGATTGACCAAGAACGTAGGGATGGGGCTTATAATTTGATGATGTTGTCGAGTGATTCTAGTAGTTTC
AAGAAAAGACGTAACATGGTGATGAATTCTCTTGGTGAGTCATCTGACAACAACTCTGCGATTGTTGAGAATAAGTCATC
TTCAGGGGATGAGTTTAAGATCATGAATGTGAAGAATGCAGTAGATGACCAATGGAGATCTGCTGATGATGATGGAGTTA
GTCTCTGTGATTCAGATGGCTCTGATTCTGATTACTTCATGAATGGTCCAAGTAAGTCGGAGTCAGACATTTCTGTTGAC
AGGAACACTGGATTTGGATCTGGATTCAACAACTCATTGATCAGGTTCAGGAATAGTAATGAGGGAGGAACAAAGTATGA
GCTGAGCAAAAGCAAGAGAGCCTTGTTTTCTTATGAAACTGATTCATGTGCAGACACAAACAGCAAGATTCATCATAGGT
TCAAAGATAGCAAATCCTCAATGGTTAAGAAAGAAGGTGGTGAGAAGGTGAAGAGCAAAGGTCATGAGTGCCCAATTTGC
TTCAGGATGTTCAAATCAGGCCAAGCTTTAGGTGGTCACAAGAGATCACATTCCATTGCAAACCACGCAGCTGAAATGCG
TAACCAAATCGATCTCTATCTTCCTGTTTCGGATACTGATGAATGA