Details for Arabidopsis Locus AT1G26580

Position : Chr1 ( 5`- 9184606 .. 9187505 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26580

Protein [Map View]
MGFKRPFEDEKFHELPLKHSRQLDYNDKSTQFEEVSPHHAGFQKTVATVNEGNLCKSQGGESSEGDMFDEESNYVYPGHD
MDDTFTWDTQGCGGRDATYSPHSGKYFELDIPPRVFAPVETFYYLLLDQRAKKQVPIGPGHQAEIPEWEGSQTGNIETSG
MSVQNHISGCADGEKLFGTSVIPMPGLTTVAHIDDIVGKGRKFCVCRDRDSVRCVCQHIKEAREELVKTFGNETFKELGL
CEMGEKGALKWSDEDAQLFHEVVYSNPVTLGQNFWRHLEAAFCSRTQKEIVSFYFNVFVLRRRAIQNRAFILDIDSDDDE
WHGCYGGSSGTRYVEEDEEDSAIESPLHQGTKKVYPLHHEEGEEDVSHSSNDEDDDDTKEGGTGLYDEHKMSSTVEYMDR
FSGNNGERLNVEDDSCTSFELARNAVNCAEKDETVPGEQQKKLKDCNDPIDTKVWDASRCLNVPTNGKDLQPTRRIMEEI
FGNGCWENKARNK*

DNA
ATGGGATTCAAACGCCCTTTTGAAGATGAGAAGTTTCATGAGCTCCCACTCAAACATTCCAGACAACTTGACTATAACGA
TAAGTCTACTCAGTTTGAAGAAGTTAGTCCTCACCATGCTGGTTTCCAGAAAACTGTTGCCACGGTGAATGAGGGAAATC
TTTGTAAGTCACAAGGCGGTGAGTCATCTGAAGGTGATATGTTTGATGAAGAGTCCAATTATGTTTACCCTGGTCATGAC
ATGGATGATACTTTTACATGGGATACACAAGGTTGTGGTGGAAGAGATGCAACTTACTCTCCCCATTCTGGAAAGTATTT
TGAGCTAGATATACCTCCAAGAGTATTTGCTCCTGTTGAGACTTTCTATTATTTACTCTTGGATCAACGTGCCAAAAAGC
AAGTGCCCATTGGACCAGGTCATCAAGCCGAGATTCCTGAATGGGAAGGCAGTCAGACTGGGAACATAGAAACCTCAGGC
ATGTCAGTTCAAAATCACATTAGTGGATGTGCTGATGGTGAGAAGCTGTTTGGTACATCTGTTATTCCCATGCCTGGTTT
GACTACAGTTGCACATATTGATGACATAGTAGGGAAGGGTAGAAAGTTTTGTGTATGCCGGGACAGGGATTCTGTCAGGT
GTGTGTGCCAGCACATTAAAGAAGCTAGAGAAGAATTAGTTAAGACGTTTGGAAATGAGACATTCAAAGAACTGGGTTTA
TGTGAGATGGGGGAAAAAGGTGCACTGAAGTGGAGCGATGAAGATGCACAACTTTTTCATGAGGTTGTTTATTCCAATCC
TGTAACATTGGGGCAGAATTTTTGGAGGCACTTGGAAGCTGCATTTTGTTCCCGAACTCAGAAAGAGATTGTTAGCTTCT
ACTTTAACGTATTTGTCCTCAGAAGGAGAGCCATCCAGAACAGAGCTTTTATATTGGACATTGATAGTGATGATGATGAA
TGGCATGGATGTTATGGAGGCTCTTCTGGTACTCGTTATGTAGAAGAAGATGAAGAAGACTCTGCAATCGAGTCTCCTCT
TCATCAAGGGACTAAGAAAGTGTATCCACTCCATCATGAAGAAGGTGAAGAAGATGTTAGTCATAGCAGCAATGATGAAG
ATGATGATGATACTAAAGAAGGTGGCACTGGACTGTATGACGAGCACAAGATGAGTTCAACAGTTGAATACATGGATAGA
TTTTCTGGGAACAATGGAGAGAGATTGAACGTGGAAGATGACTCGTGCACTTCCTTTGAACTTGCACGTAATGCAGTCAA
CTGTGCAGAGAAAGATGAGACTGTTCCTGGAGAGCAGCAGAAGAAGTTGAAGGATTGTAATGATCCAATAGATACCAAAG
TCTGGGATGCTTCGAGGTGTTTGAATGTTCCAACAAATGGCAAAGATCTTCAACCAACCCGGAGAATCATGGAGGAGATA
TTTGGTAATGGATGCTGGGAAAACAAGGCAAGAAACAAGTGA