Details for Arabidopsis Locus AT1G26520

Position : Chr1 ( 5`- 9163246 .. 9165900 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26520

Protein [Map View]
MLKEEAEGVKMEDDDEEPPMAVQIHPDVSVGKVHSSSDTVSVGVSVITGYLGAGKSTLVNYILNGKHGKRIAVILNEFGE
EIGVERAMINEGEEGAIVEEWVELANGCVCCTVKHSLVQALEQLVQRKDRLDHILLETTGLANPAPLASILWLDDQLESE
VKLDCIVTVVDAKNLRFQLNERRDSSSFPEAFNQIAFADTIIMNKVDLISQEESDELEKEIHSINSLANVIRSVRCQVDL
SNILNCQAYDSTHVSRLESLLEANKSLTTTDLHDSGVRTLCISEPQPINLDKVRLWLEEILWDKKSEMDVYRCKAVLSIQ
NSDQMHILQAVRDIYEIVPARKWSEEENRTNKIVFIGHKLDEEVLRSGLRDCRP*

DNA
ATGCTGAAGGAAGAAGCTGAGGGAGTGAAAATGGAAGATGATGATGAAGAACCACCGATGGCTGTTCAAATCCATCCGGA
TGTTTCTGTCGGAAAGGTTCACTCATCAAGCGATACTGTTTCAGTTGGTGTGTCTGTTATCACTGGCTATCTCGGCGCGG
GAAAATCCACTCTTGTGAATTATATATTGAACGGGAAACACGGGAAGAGAATAGCTGTGATTTTGAATGAGTTTGGGGAA
GAGATTGGAGTTGAGAGGGCTATGATTAACGAAGGAGAAGAAGGTGCCATTGTTGAAGAATGGGTTGAGCTCGCTAATGG
CTGTGTTTGTTGTACTGTCAAGCATAGTCTTGTTCAAGCTCTCGAGCAGCTTGTTCAGAGAAAAGACAGGCTTGATCATA
TATTATTGGAGACAACAGGTTTAGCAAACCCAGCTCCATTGGCTTCTATTCTTTGGTTGGATGACCAGTTAGAATCAGAA
GTCAAGCTTGACTGTATTGTTACTGTCGTGGATGCAAAGAATCTTCGTTTTCAGCTCAATGAGCGTCGTGACTCATCCTC
GTTTCCTGAGGCCTTTAATCAAATAGCATTTGCGGACACGATAATAATGAACAAGGTGGACTTGATTTCTCAAGAGGAGT
CTGATGAATTAGAGAAGGAGATTCATTCCATCAACTCGCTCGCCAATGTCATCCGATCTGTTAGGTGCCAAGTTGATTTG
TCCAATATATTAAACTGCCAGGCATATGATTCAACTCATGTTAGTCGTCTGGAATCCCTGCTGGAAGCAAATAAATCATT
AACGACGACAGATCTTCACGATAGTGGAGTAAGGACTCTATGCATCAGCGAACCGCAACCTATAAACCTCGATAAGGTTC
GTTTATGGCTGGAGGAAATTCTGTGGGATAAAAAATCGGAGATGGATGTATACCGTTGCAAGGCTGTGTTGAGCATTCAA
AACTCAGACCAGATGCATATTTTGCAGGCCGTTAGAGATATATATGAGATAGTGCCAGCTCGAAAATGGAGCGAGGAAGA
GAATCGAACAAACAAAATAGTATTTATAGGACACAAACTGGATGAAGAAGTTCTCAGAAGCGGATTAAGAGATTGCAGAC
CCTAG