Details for Arabidopsis Locus AT1G26500

Position : Chr1 ( 5`- 9158380 .. 9159897 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26500

Protein [Map View]
MAVAVVTSRRMINIGNSIRRCFILNHRFFSTELTPTTITPINQDHLLRVCTILYQQQNSPDSRLVSKLSSTKFQLTHEFF
LQVCNNFPLSWRPVHRFFLYSQTHHPDFTHTSTTSNKMLAIIGNSRNMDLFWELAQEIGKRGLVNDKTFRIVLKTLASAR
ELKKCVNYFHLMNGFGYLYNVETMNRGVETLCKEKLVEEAKFVFIKLKEFIKPDEITYRTMIQGFCDVGDLIEAAKLWNL
MMDEGFDVDIEAGKKIMETLLKKNQFDEASKVFYVMVSKRGGDLDGGFYRVMIDWLCKNGRIDMARKVFDEMRERGVYVD
NLTWASLIYGLLVKRRVVEAYGLVEGVENPDISIYHGLIKGLVKIKRASEATEVFRKMIQRGCEPIMHTYLMLLQGHLGR
RGRKGPDPLVNFDTIFVGGMIKAGKRLETTKYIERTLKRGLEVPRFDYSKFLHYYSNEEGVVMFEEMAKKLREVSLFDLA
DIFQRYGEKMTTRERRRDRDQLLKT*

DNA
ATGGCTGTGGCCGTCGTGACTTCTCGGAGGATGATTAACATCGGAAACTCAATTCGGCGATGCTTCATTCTCAACCACCG
CTTCTTCTCCACCGAGCTAACTCCAACCACAATCACACCGATAAACCAAGACCATCTTCTCCGAGTCTGTACAATTCTCT
ACCAGCAACAGAACTCACCTGATTCACGTCTCGTCTCTAAACTCTCCTCCACCAAATTTCAACTAACTCACGAGTTCTTC
CTCCAAGTCTGCAACAATTTCCCACTCTCGTGGCGTCCTGTACACCGTTTCTTCCTCTATTCTCAAACTCACCACCCTGA
TTTCACCCACACTTCCACTACCTCTAATAAGATGCTAGCAATCATCGGGAACTCAAGAAACATGGATCTTTTCTGGGAAT
TAGCTCAAGAGATCGGAAAACGTGGATTGGTTAACGATAAGACATTTCGGATTGTGTTGAAAACACTTGCTTCTGCTAGA
GAGTTGAAGAAATGTGTAAACTATTTCCATTTGATGAACGGTTTTGGGTATTTGTATAATGTGGAAACGATGAATAGAGG
AGTGGAGACTCTGTGTAAGGAGAAGCTTGTTGAAGAAGCTAAGTTTGTTTTTATTAAGCTGAAGGAGTTTATTAAACCTG
ATGAGATTACTTATAGGACGATGATACAAGGGTTTTGTGATGTTGGTGATTTGATTGAAGCTGCTAAGCTTTGGAATTTG
ATGATGGATGAAGGATTTGATGTTGATATCGAAGCTGGTAAAAAGATTATGGAAACACTTCTGAAGAAGAATCAGTTTGA
TGAAGCTTCTAAGGTGTTTTATGTTATGGTTTCGAAAAGAGGTGGTGATTTGGATGGGGGTTTCTACAGGGTGATGATTG
ATTGGTTGTGTAAAAACGGTAGGATTGATATGGCACGTAAGGTGTTCGATGAAATGCGTGAGAGAGGTGTTTATGTGGAT
AACTTAACTTGGGCGTCGTTAATCTATGGACTGTTGGTTAAACGAAGAGTTGTAGAGGCTTATGGGTTGGTGGAAGGGGT
TGAGAATCCGGATATTAGTATCTATCATGGGTTGATAAAAGGGTTGGTGAAGATTAAACGGGCAAGCGAAGCAACAGAGG
TTTTCAGGAAGATGATACAGAGAGGGTGCGAGCCAATAATGCATACGTATCTTATGTTGTTGCAAGGACATTTGGGGAGA
AGGGGAAGGAAAGGGCCGGACCCGTTAGTGAATTTCGATACGATATTCGTTGGAGGTATGATCAAGGCGGGGAAACGGTT
GGAAACTACAAAGTATATTGAGAGAACGTTGAAGAGAGGGCTTGAAGTTCCTAGGTTTGATTATAGCAAGTTCTTGCATT
ATTATTCTAATGAGGAAGGTGTGGTTATGTTTGAAGAGATGGCTAAGAAACTTAGAGAAGTGAGTTTGTTTGATTTGGCT
GATATATTCCAGAGGTATGGAGAGAAGATGACTACAAGAGAGAGAAGGAGAGATAGAGACCAATTATTGAAGACGTAG