Details for Arabidopsis Locus AT1G26480

Position : Chr1 ( 5`- 9156329 .. 9157950 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26480

Protein [Map View]
MSSSGSDKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKG
NESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATVFYYKMKGDYYRYLAEFKTEQERKEAAEQSLKGYEA
ATQAASTELPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD
LPEDGGEDNIKTEESKQEQAKPADATEN*

DNA
ATGTCATCATCAGGATCCGACAAAGAGAGAGAGACTTTTGTCTATATGGCTAAGCTCTCCGAACAAGCCGAGCGATACGA
CGAGATGGTGGAGACGATGAAGAAAGTGGCGAGGGTTAATAGCGAGCTGACTGTGGAAGAGAGGAATCTGTTGTCGGTTG
GTTACAAGAACGTGATCGGAGCAAGAAGAGCTTCGTGGAGGATAATGTCGTCCATCGAGCAGAAAGAAGAGTCTAAAGGC
AATGAATCAAACGTGAAACAAATCAAGGGTTATCGCCAAAAGGTAGAAGATGAGCTCGCTAACATTTGCCAAGACATTCT
CACCATCATTGATCAGCATCTCATCCCTCACGCTACCTCAGGGGAAGCTACCGTCTTCTACTACAAGATGAAAGGAGATT
ATTACCGTTACTTGGCTGAGTTTAAGACCGAGCAAGAGAGGAAGGAAGCTGCTGAACAGTCTCTCAAAGGCTATGAGGCT
GCAACACAAGCTGCAAGCACTGAGCTTCCTTCGACCCATCCAATTCGTCTTGGCCTTGCTCTTAACTTCTCTGTTTTCTA
CTATGAGATCATGAACTCTCCTGAAAGAGCTTGCCATTTGGCTAAGCAAGCCTTCGATGAGGCGATTGCAGAGTTAGATA
CTCTAAGTGAGGAGTCGTACAAGGACAGCACTTTGATCATGCAGCTCCTGAGAGACAACCTCACCCTCTGGACTTCTGAT
CTTCCTGAAGATGGAGGAGAAGACAACATCAAGACTGAAGAATCCAAGCAAGAACAGGCCAAGCCTGCCGATGCCACTGA
GAACTGA