Details for Arabidopsis Locus AT1G26440

Position : Chr1 ( 5`- 9143967 .. 9146050 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26440

Protein [Map View]
MMIAQELGIYVVESKGGAILCLLLSLLCLGTWPALMALLERRGRLPQHTYLDYSITNFLAAIFIAFVFGGIGESTHEAPS
FITQLTQIQDNWPSVLFAMAGGVGLSIGNLATQYSLAFVGLSVTEVTAASITVVVGTTVNYFLDNGLNRADILFSGVGCF
MVAVCLGSAVHSSNSADIKAKLGKLSGDCETVTPEECQRLFGVEEEEEEEKEMENVKEGSAAFLIALENKRAIKVLGKSM
VVGLGITFFAGLSFSLFSPLFNLATNDQWHTLKQGVPKLIVYTAFFYFSLSCFVIAVALNISFLYKPVLDSPRSSFREYL
SDWNGRGWALAAGLLCGFGNGLQFMGGQAAGYAASDAVQALPLVSTFWGIYLFGEYRRSSTRTYALLVGMLVMFTVAVGL
LMASAGERETRFT*

DNA
ATGATGATAGCTCAAGAATTGGGAATATATGTTGTGGAGAGCAAAGGAGGAGCAATATTATGTCTATTGCTTTCTCTGCT
CTGTTTAGGCACTTGGCCTGCTCTTATGGCTCTTCTTGAACGGCGTGGTCGTCTCCCACAACATACTTATCTTGATTATT
CCATCACTAACTTTTTGGCTGCAATCTTTATAGCCTTTGTGTTTGGTGGGATAGGTGAAAGTACACATGAGGCACCAAGT
TTCATTACACAACTCACTCAGATTCAAGATAATTGGCCCTCTGTGTTGTTTGCAATGGCGGGTGGGGTTGGTTTAAGTAT
TGGAAACCTTGCTACTCAGTATTCTTTAGCTTTTGTTGGTCTGTCTGTTACAGAAGTGACAGCTGCGAGCATCACCGTTG
TTGTAGGCACTACTGTCAATTACTTTTTGGACAACGGATTGAACAGAGCTGATATTCTTTTCTCTGGTGTTGGTTGCTTC
ATGGTAGCTGTTTGTCTTGGTTCTGCTGTTCACTCTTCCAATTCTGCTGATATCAAGGCGAAACTCGGAAAACTCTCAGG
GGATTGTGAAACTGTGACCCCTGAAGAGTGCCAGAGACTATTTGGAGTAGAAGAAGAAGAAGAAGAAGAAAAAGAGATGG
AGAATGTAAAGGAAGGGTCTGCAGCTTTTCTTATAGCACTCGAAAACAAAAGAGCAATCAAAGTGTTAGGAAAGAGCATG
GTTGTTGGTCTGGGAATAACTTTTTTTGCAGGACTTTCTTTCTCATTGTTCTCACCACTATTCAACCTTGCAACAAACGA
TCAATGGCACACTCTAAAACAAGGCGTTCCCAAGCTGATTGTCTACACTGCGTTCTTCTACTTCTCACTATCTTGCTTTG
TAATCGCGGTCGCTCTCAACATTAGTTTCCTGTACAAACCTGTGCTAGACTCACCAAGATCTTCCTTTAGAGAATACCTG
AGTGACTGGAACGGAAGAGGTTGGGCACTTGCAGCTGGATTGTTATGTGGGTTTGGTAACGGTCTTCAGTTCATGGGTGG
ACAAGCTGCAGGATATGCAGCCTCAGATGCTGTTCAGGCACTTCCTTTAGTATCGACTTTTTGGGGGATATATCTGTTTG
GGGAGTATAGGAGATCATCTACGCGAACATATGCTTTGCTTGTTGGAATGCTGGTGATGTTTACTGTTGCTGTGGGGCTT
CTAATGGCCTCGGCTGGGGAAAGAGAGACGCGATTTACTTAG