Details for Arabidopsis Locus AT1G18590

Position : Chr1 ( 5`- 6398580 .. 6399942 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18590

Protein [Map View]
MESKTINDVVVSESNHELASSSPSEFEKNQKHYQEIIATLPHKDGWRPKDPFVEYGGHWWLQPLLEGLLHAQKFFKARPN
DFFVCSYPKTGTTWLKALTFAIANRSKFDVSTNPLLKRNPHEFVPYIEIDFPFFPSVDVLKDEGNTLFSTHIPYDLLPES
VVKSGCKIVYIWRDPKDTFVSMWTFAHKERSQQGPVVSIEEAFDKYCQGLSAYGPYLDHVLGYWKAYQANPDQILFLKYE
TMRADPLPYVKRLAEFMGYGFTKEEEEGNVVEKVVKLCSFETLKNLEANKGEKDREDRPAVYANSAYFRKGKVGDWQNYL
TPEMVARIDGLMEEKFKGTGFLSSKS*

DNA
ATGGAATCCAAAACCATAAACGACGTCGTCGTATCAGAGTCAAATCACGAGTTAGCATCTTCGTCGCCATCAGAATTTGA
GAAGAACCAGAAACATTACCAAGAAATCATCGCAACTCTTCCTCACAAAGATGGCTGGAGACCAAAAGATCCGTTCGTTG
AGTACGGTGGTCACTGGTGGCTACAACCTCTTCTTGAAGGTTTACTTCACGCCCAGAAGTTCTTCAAGGCACGTCCCAAT
GATTTCTTCGTCTGCAGCTACCCAAAAACCGGCACGACTTGGCTCAAAGCCTTAACTTTCGCAATCGCAAATCGCTCCAA
GTTCGACGTTTCAACAAACCCTCTTCTCAAACGTAATCCACACGAGTTTGTGCCTTACATCGAAATCGACTTCCCGTTTT
TCCCAAGCGTTGATGTTCTTAAAGACGAAGGAAACACGCTTTTCTCGACTCATATCCCTTATGATCTCTTACCTGAATCA
GTTGTGAAATCTGGTTGCAAGATTGTTTACATATGGAGAGACCCAAAGGACACGTTTGTGTCGATGTGGACTTTTGCTCA
CAAGGAGAGATCACAACAAGGACCAGTGGTTAGCATTGAGGAAGCTTTTGATAAGTACTGTCAAGGTTTATCAGCTTACG
GTCCTTATCTTGATCATGTTTTAGGGTATTGGAAAGCTTACCAAGCAAACCCGGATCAGATTTTGTTTCTCAAGTATGAG
ACAATGAGAGCTGATCCATTGCCTTATGTGAAGAGATTAGCTGAGTTTATGGGTTATGGGTTCACGAAGGAGGAAGAGGA
GGGAAATGTTGTTGAGAAAGTAGTGAAGCTTTGTAGCTTTGAGACTTTGAAGAATCTTGAAGCTAACAAAGGTGAGAAAG
ATAGAGAAGATCGTCCTGCTGTTTATGCCAACAGTGCGTATTTCAGGAAAGGGAAAGTTGGGGATTGGCAGAATTATCTG
ACTCCGGAGATGGTGGCTCGTATTGATGGTTTGATGGAAGAGAAGTTTAAAGGAACTGGCTTTCTTTCTTCAAAATCATG
A