Details for Arabidopsis Locus AT1G18550

Position : Chr1 ( 5`- 6381503 .. 6384340 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18550

Protein [Map View]
MPVSTRSKVMKQERNEQENTNLNLPLRNPHQGLKEKMRALTLLYEQQKRASFSLRNPNHNQSPKPEDQRFKTQLLDSSKK
GDRFHRLDGKDSTFVEEDTKENNVFEADRIFGVSSVPVKPSGVIRKLSMGNGARNVSEAEKLESLNASVSRILVFVRLRP
MGKKERENGSRCCVKVLNKRDVYLTEFTNENDYLRLKRLRVRHFTFDSSFPETTTQQEVYSTTTGDLVEAVLEGRNGSVF
CYGATGAGKTYTMLGTMENPGVMVLAIKDLFAKVRQRSLDGNHVVHLSYLEVYNETVRDLLSPGRPLILREDKQGIVAAG
LTQYRAYSTDEVMALLQRGNQNRTTEPTRCNETSSRSHAILQVIVEYKTRDASMNIISRVGKLSLIDLAGSERALATDQR
TLRSLEGANINRSLLALSSCINALVEGKKHIPYRNSKLTQLLKDSLGGSCNTVMIANISPSSQSFGETQNTLHWADRAKE
IRVKECEVNEEVVQVGEEEGADQAKLLLELQKENSELRVQLAKQQQKLLTLQAENIAAANNNNNISLTPPSISSLMTPPS
ALTAQQKKKPRHSLLSGTCFTPESLKRTKAEEAVKELQLTVKALKMEMERMKREHGLQMKKQKDELMKDLCSRKSEKTPE
RCKETRRIVTRGSLRPKEKEKELKSPSHRFASPVAAAKKRSFWDITVANTSPALDRRKTRSHGLVHQEAPSKLLQPGFAR
PHMKH*

DNA
ATGCCGGTATCTACTCGATCTAAGGTGATGAAACAGGAGCGAAACGAGCAAGAGAACACAAATCTGAATCTTCCGTTGAG
AAATCCACATCAAGGGTTGAAGGAAAAGATGAGAGCTTTGACTCTCTTGTACGAGCAGCAAAAGAGAGCCTCTTTCTCTC
TCAGGAACCCTAATCATAATCAGTCTCCGAAACCTGAAGATCAGAGATTCAAGACTCAGCTGCTTGATTCTTCCAAGAAA
GGAGACAGATTTCATCGCCTGGACGGTAAAGATTCTACCTTTGTTGAAGAAGATACCAAAGAGAACAATGTATTTGAAGC
AGATCGGATTTTTGGGGTTAGTTCGGTTCCTGTTAAGCCTAGTGGTGTGATTAGGAAGCTTTCAATGGGTAATGGAGCTA
GAAACGTTTCGGAAGCTGAGAAATTGGAGAGTCTTAATGCTTCTGTGAGTCGGATTTTGGTGTTTGTTAGGCTTAGACCA
ATGGGGAAAAAGGAAAGAGAGAATGGGTCAAGGTGTTGTGTCAAGGTTTTGAATAAAAGAGATGTTTACCTAACGGAGTT
TACGAATGAGAATGATTACCTTAGGCTTAAGAGGCTCCGTGTTCGTCATTTCACTTTTGATTCTTCATTTCCTGAAACTA
CCACACAACAAGAGGTTTATTCCACCACAACAGGAGATCTTGTTGAAGCAGTTCTTGAAGGAAGAAATGGTTCAGTTTTC
TGCTACGGTGCTACGGGAGCAGGCAAGACTTATACGATGTTAGGGACAATGGAGAATCCAGGTGTAATGGTTCTAGCAAT
CAAAGATTTGTTTGCTAAAGTTAGACAGAGAAGCTTAGATGGGAACCATGTTGTTCATCTTTCTTATCTTGAGGTTTATA
ATGAAACTGTTAGAGATTTGCTTTCACCTGGTAGACCTCTCATTCTCCGTGAAGATAAGCAGGGAATTGTGGCTGCTGGT
CTCACTCAATATAGAGCTTACTCAACAGATGAGGTTATGGCTTTGCTTCAAAGGGGAAATCAAAACAGAACTACCGAGCC
TACTCGTTGCAATGAAACATCTTCTCGCTCACATGCCATCCTTCAGGTAATAGTGGAGTATAAGACTAGAGATGCTTCCA
TGAATATCATCAGCCGGGTAGGAAAGCTATCTCTCATTGATCTTGCGGGTTCTGAAAGAGCGCTAGCAACTGATCAAAGG
ACGCTCAGATCACTGGAAGGTGCAAACATAAACAGATCACTTCTTGCATTAAGTAGTTGCATTAACGCGCTTGTGGAAGG
CAAGAAACATATTCCTTACAGAAACTCAAAGCTCACACAACTACTCAAAGACTCACTAGGCGGCTCGTGTAACACGGTGA
TGATTGCTAATATAAGTCCAAGCAGTCAATCTTTTGGTGAAACACAAAACACTCTCCATTGGGCTGATCGAGCCAAGGAG
ATTCGTGTGAAGGAATGTGAAGTAAATGAAGAGGTGGTTCAAGTGGGTGAAGAAGAAGGAGCTGATCAGGCTAAGCTTTT
GTTAGAACTTCAAAAAGAGAATAGTGAATTGCGTGTCCAGCTAGCAAAGCAGCAGCAAAAGCTTTTGACTCTACAAGCAG
AGAACATAGCCGCTGCTAATAACAACAACAACATTTCTCTGACACCTCCATCAATCTCATCTCTTATGACTCCACCGTCT
GCATTAACAGCTCAGCAGAAGAAGAAACCAAGGCATTCGTTGTTATCAGGGACATGTTTCACACCAGAATCATTGAAAAG
GACAAAAGCAGAAGAAGCTGTGAAGGAACTTCAGCTGACTGTTAAGGCATTGAAGATGGAGATGGAGAGAATGAAGAGGG
AACATGGTTTGCAGATGAAGAAGCAAAAAGACGAATTAATGAAAGATCTTTGTAGTAGAAAGAGCGAGAAAACTCCAGAA
AGATGCAAAGAAACAAGGAGGATTGTCACAAGAGGGAGCTTGAGACCAAAGGAGAAGGAAAAGGAACTGAAAAGTCCGAG
TCATCGGTTTGCATCTCCAGTTGCAGCAGCTAAAAAGAGAAGCTTTTGGGACATAACCGTTGCTAATACTAGTCCTGCGT
TGGATAGAAGGAAAACGAGAAGCCACGGTCTTGTTCATCAAGAAGCTCCTTCAAAACTGCTTCAGCCCGGGTTTGCTCGT
CCACACATGAAGCATTAA