Details for Arabidopsis Locus AT1G18540

Position : Chr1 ( 5`- 6377321 .. 6378580 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18540

Protein [Map View]
MPAAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDAPVEKPAKFYPAEDVKKPLVNRRKP
KPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNTEKFDDKY
FGKVAEKKKKKTEGEFFEAEKEEKKEIPQEKKEDQKTVDAALIKSIEAVPELKVYLGARFSLSQGMKPHELVF*

DNA
ATGCCGGCGGCGAAGAGGACTCCCAAGGTTAACCGTAACCCTGACCTAATCAGGGGAGTTGGAAAATATTCGAGGTCTCA
GATGTACCACAAGAGAGGTTTGTGGGCTATCAAGGCCAAGAACGGTGGCGTTTTCCCTCGTCACGATGCTCAGCCAAAGG
TCGACGCTCCGGTTGAGAAGCCTGCCAAGTTTTATCCGGCGGAAGACGTCAAGAAGCCGCTTGTTAACAGACGCAAGCCT
AAGCCTACCAAGCTAAAAGCCAGCATCACTCCAGGAACTGTGTTGATCATTCTTGCTGGTAGATTCAAGGGTAAGAGAGT
TGTCTTCCTCAAGCAACTTTCTTCTGGTTTGCTTCTTGTAACAGGACCATTCAAGATTAATGGTGTTCCATTGAGACGTG
TTAACCAAGCCTATGTGATTGGAACCTCCACAAAGATTGACATTTCTGGAGTCAACACTGAGAAATTCGATGACAAGTAT
TTTGGAAAGGTTGCTGAGAAGAAGAAGAAGAAAACAGAAGGCGAATTCTTCGAAGCTGAGAAAGAGGAGAAGAAGGAGAT
CCCACAGGAGAAGAAGGAAGACCAGAAAACCGTTGATGCTGCTCTGATCAAATCCATTGAAGCTGTCCCAGAGCTCAAGG
TTTACCTTGGAGCCAGGTTCTCATTGAGTCAAGGAATGAAACCACATGAGCTTGTTTTCTAG