Details for Arabidopsis Locus AT1G18530

Position : Chr1 ( 5`- 6376783 .. 6377256 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18530

Protein [Map View]
MEDQIRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDSNGNGFVEFDELVGTILPDLNEEVLINS
EQLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADTNGDGVISFGEFASIMAKSAVDYFGLKINS*

DNA
ATGGAGGATCAGATAAGACAACTTAAAGACATTTTCGACCGGTTCGACATGGACGCAGACGGAAGCTTAACAATCTTAGA
ACTCGCGGCACTTCTCCGGTCACTCGGTCTCAAACCTTCCGGCGATCAAATCCATGTTTTGTTAGCTAGCATGGACTCAA
ACGGCAACGGTTTTGTCGAATTCGATGAGCTCGTTGGTACAATTCTTCCTGATCTTAACGAAGAGGTCCTAATCAATTCC
GAGCAATTACTCGAGATTTTCAAATCGTTCGATAGAGACGGTAACGGGTTCATAAGTGCGGCTGAGCTTGCAGGAGCAAT
GGCCAAGATGGGTCAACCATTAACGTATAAAGAATTAACGGAGATGATCAAAGAAGCTGATACAAATGGTGATGGTGTTA
TAAGCTTTGGAGAGTTTGCTTCAATTATGGCAAAATCTGCTGTTGATTACTTTGGATTAAAAATTAATTCGTGA