Details for Arabidopsis Locus AT1G18520

Position : Chr1 ( 5`- 6374932 .. 6376316 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18520

Protein [Map View]
MFRVSNFMVGLANTLVMLVGASAIGYSIYMFVHQGVTDCESAIRIPLLTTGLILFLVSLLGVIGSCFKENLAMVSYLIIL
FGGIVALMIFSIFLFFVTNKGAGRVVSGRGYKEYRTVDFSTWLNGFVGGKRWVGIRSCLAEANVCDDLSDGRVSQIADAF
YHKNLSPIQSGCCKPPSDCNFEFRNATFWIPPSKNETAVAENGDCGTWSNVQTELCFNCNACKAGVLANIREKWRNLLVF
NICLLILLITVYSCGCCARRNNRTARKSDSV*

DNA
ATGTTTCGAGTTAGCAATTTCATGGTTGGTCTAGCAAACACATTGGTGATGTTAGTGGGCGCTTCGGCCATTGGTTATTC
GATTTACATGTTCGTTCACCAAGGCGTCACTGATTGTGAATCTGCCATTCGGATACCACTTCTCACGACCGGACTCATCC
TCTTCTTGGTGTCTTTGCTCGGAGTGATTGGATCTTGTTTCAAGGAGAATTTGGCAATGGTTTCCTACTTGATCATATTG
TTTGGGGGCATTGTTGCATTGATGATTTTCTCCATATTTCTCTTCTTTGTGACCAACAAAGGAGCCGGTCGTGTGGTGTC
CGGTCGAGGGTATAAAGAGTACCGGACGGTGGATTTCTCGACGTGGCTTAATGGGTTCGTTGGTGGGAAGAGATGGGTTG
GGATAAGGTCTTGTTTGGCTGAGGCTAACGTTTGTGATGATTTGAGTGATGGTCGTGTTAGTCAGATCGCTGATGCGTTT
TATCACAAGAACTTGTCTCCCATCCAGTCAGGTTGTTGTAAGCCACCATCGGATTGCAACTTCGAGTTCAGAAACGCGAC
GTTCTGGATACCGCCGAGCAAAAACGAAACGGCAGTTGCGGAAAACGGGGACTGTGGTACGTGGAGCAACGTGCAAACAG
AGTTATGTTTCAACTGCAACGCATGCAAAGCGGGTGTGTTAGCGAACATAAGAGAGAAGTGGAGGAATCTTCTTGTTTTC
AACATTTGTCTCCTCATTCTCCTCATAACCGTCTATTCCTGCGGTTGCTGTGCTCGTCGTAACAATCGGACGGCTAGGAA
AAGTGATTCTGTCTGA