Details for Arabidopsis Locus AT1G18510

Position : Chr1 ( 5`- 6373295 .. 6374090 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18510

Protein [Map View]
MATIILICIGLTMTGTGLYYRKTVSKCIRETDGSFVVIGLLLLVIPQFALYAICCHSKRMFTIYIYAMIFVSIVLGGYSL
KCFIYNTTFGIAKNPAEEKRTAKQLVGRLVPESKLAKVTECIIHNHDCNFNASQNSNVWRYCCAQPRGCGVTTMFGQPGE
WSWKHQHVENHVPEECSYEYCLSCRGCQMSILKAIVHQWKYLSMFSYPALFLVCLSLAISRSIMDTFDEPDDYRGYYS*

DNA
ATGGCGACCATAATCCTTATATGCATAGGCTTAACAATGACGGGAACAGGTTTATATTACAGAAAAACAGTCTCGAAATG
TATCCGAGAAACGGATGGCAGTTTCGTCGTCATTGGTTTGCTCTTGCTGGTGATTCCTCAGTTTGCTCTTTACGCAATCT
GTTGTCACTCAAAACGTATGTTCACAATCTACATCTATGCAATGATATTCGTAAGCATTGTCCTTGGTGGCTACTCTTTA
AAGTGTTTCATCTACAACACAACCTTTGGAATCGCCAAGAACCCGGCTGAGGAAAAGCGAACCGCCAAGCAATTGGTAGG
CAGGCTAGTCCCTGAAAGTAAACTTGCAAAAGTCACGGAGTGCATCATTCATAACCATGACTGTAACTTCAATGCCAGCC
AAAACAGCAATGTTTGGAGGTATTGCTGCGCGCAACCAAGAGGATGTGGAGTGACGACAATGTTCGGGCAACCAGGAGAA
TGGAGTTGGAAACATCAACACGTAGAGAACCATGTTCCGGAAGAATGTTCTTACGAATACTGTCTCAGTTGCAGAGGTTG
CCAGATGAGCATCTTAAAAGCCATTGTTCATCAATGGAAATATCTCTCCATGTTCTCTTATCCTGCCCTCTTTCTCGTTT
GTCTCAGCCTCGCCATTTCCAGGTCCATTATGGATACTTTCGATGAACCTGATGATTATAGGGGCTATTATTCTTGA