Details for Arabidopsis Locus AT1G18500

Position : Chr1 ( 5`- 6369347 .. 6373025 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18500

Protein [Map View]
MASSLLRNPNLYSSTTITTTSFLPTFSSKPTPISSSFRFQPSHHRSISLRSQTLRLSCSISDPSPLPPHTPRRPRPEYIP
NRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAETVGNTVDENGYVP
VICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSDIHLEYKLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSE
REYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGARQMEV
TINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGML
KHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALKDRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDE
VFQPEAVWKLLDIQITCGTLGLSTATVKLADADGKEHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIA
TTRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDFKENSATKIPSQKNRVAA*

DNA
ATGGCGTCTTCGCTTCTGAGAAACCCTAATCTCTACTCATCAACAACAATCACCACCACTTCTTTTCTTCCCACCTTCTC
CTCTAAACCCACACCTATCTCCTCCTCTTTCCGTTTCCAACCATCTCACCACCGTTCAATCTCCCTCCGAAGTCAAACCC
TCCGTCTCTCATGCTCAATCTCAGATCCTTCTCCACTACCACCTCACACTCCTCGCCGTCCCCGTCCTGAATACATCCCC
AACCGCATTTCCGATCCAAACTACGTCCGCGTCTTCGATACTACTCTCCGTGACGGTGAACAATCTCCAGGAGCTACACT
TACTTCCAAGGAAAAACTTGACATCGCTCGTCAGCTAGCTAAACTTGGTGTTGACATCATCGAGGCTGGGTTTCCTGCTG
CTTCCAAGGATGATTTTGAAGCGGTTAAGACTATAGCTGAAACAGTTGGAAACACTGTTGATGAGAATGGTTATGTTCCT
GTTATCTGTGGACTCTCTAGATGCAATAAGAAGGATATTGAGAGAGCTTGGGATGCTGTGAAATACGCTAAACGGCCTAG
GATTCATACTTTTATAGCTACTAGTGATATACATTTGGAGTATAAACTAAAGAAAACCAAAGCAGAGGTCATCGAAATCG
CTAGGAGTATGGTTAGATTCGCGAGGAGCTTGGGGTGCGAAGATGTTGAGTTCAGTCCAGAAGATGCAGGAAGATCGGAG
AGAGAGTACTTATACGAGATTCTTGGTGAAGTGATAAAAGCAGGAGCAACAACTCTCAACATACCTGATACTGTTGGTAT
AACTTTGCCTAGTGAGTTTGGTCAACTGATTACTGATTTAAAGGCCAATACTCCGGGGATTGAAAATGTTGTCATCTCAA
CACATTGTCAGAATGATCTTGGACTCTCTACGGCCAACACTTTATCTGGGGCACATGCAGGTGCGAGGCAGATGGAAGTG
ACGATCAATGGAATTGGTGAAAGAGCTGGAAACGCTTCACTGGAAGAGGTTGTGATGGCCATAAAATGCCGTGGAGATCA
TGTATTAGGAGGTCTATTTACCGGAATTGATACTCGGCACATTGTTATGACAAGCAAGATGGTAGAGGAGTACACTGGGA
TGCAGACACAACCTCATAAGGCTATTGTAGGAGCGAATGCCTTTGCGCATGAAAGTGGAATTCACCAGGATGGAATGCTG
AAACACAAGGGTACATATGAAATTATATGTCCCGAAGAAATTGGACTTGAACGATCAAATGATGCTGGCATTGTCTTGGG
GAAGCTTAGTGGGCGTCATGCGCTGAAAGACCGTTTGACTGAGCTTGGTTATCAATTAGATGATGAACAGCTAAGTACCA
TTTTCTGGCGCTTCAAAACCGTGGCTGAGCAGAAAAAGAGAGTTACTGATGCGGACATAATAGCTTTAGTATCTGATGAA
GTTTTCCAGCCAGAAGCCGTGTGGAAACTCCTGGACATTCAGATAACTTGTGGAACTCTCGGGCTTTCAACAGCAACTGT
AAAACTTGCTGACGCTGATGGCAAAGAACATGTCGCTTGTTCTATTGGAACTGGGCCTGTGGATTCAGCTTACAAGGCAG
TAGATCTTATCGTAAAGGAACCGGCTACTCTGCTTGAGTACTCAATGAATGCAGTAACAGAAGGCATTGATGCCATCGCA
ACCACAAGAGTTCTTATCCGTGGAAGCAACAAATACTCATCTACAAACGCAATAACTGGTGAAGAGGTTCAAAGAACCTT
TAGTGGAACTGGAGCAGGAATGGATATTGTGGTGTCAAGCGTCAAAGCTTATGTTGGAGCTTTGAACAAAATGATGGACT
TCAAAGAAAACTCCGCCACAAAAATCCCTTCCCAAAAAAACAGAGTCGCTGCCTGA