Details for Arabidopsis Locus AT1G18485

Position : Chr1 ( 5`- 6363172 .. 6366235 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18485

Protein [Map View]
MASVLLPLPQVFVLFDYRRSRKESSFPRAVYNSNSISSNSTNANHFLRRISNFCETGDLDKSFRTVQEFVGDDESSSDAF
LLVREALGLLLQASGKRKDIEMGRKIHQLVSGSTRLRNDDVLCTRIITMYAMCGSPDDSRFVFDALRSKNLFQWNAVISS
YSRNELYDEVLETFIEMISTTDLLPDHFTYPCVIKACAGMSDVGIGLAVHGLVVKTGLVEDVFVGNALVSFYGTHGFVTD
ALQLFDIMPERNLVSWNSMIRVFSDNGFSEESFLLLGEMMEENGDGAFMPDVATLVTVLPVCAREREIGLGKGVHGWAVK
LRLDKELVLNNALMDMYSKCGCITNAQMIFKMNNNKNVVSWNTMVGGFSAEGDTHGTFDVLRQMLAGGEDVKADEVTILN
AVPVCFHESFLPSLKELHCYSLKQEFVYNELVANAFVASYAKCGSLSYAQRVFHGIRSKTVNSWNALIGGHAQSNDPRLS
LDAHLQMKISGLLPDSFTVCSLLSACSKLKSLRLGKEVHGFIIRNWLERDLFVYLSVLSLYIHCGELCTVQALFDAMEDK
SLVSWNTVITGYLQNGFPDRALGVFRQMVLYGIQLCGISMMPVFGACSLLPSLRLGREAHAYALKHLLEDDAFIACSLID
MYAKNGSITQSSKVFNGLKEKSTASWNAMIMGYGIHGLAKEAIKLFEEMQRTGHNPDDLTFLGVLTACNHSGLIHEGLRY
LDQMKSSFGLKPNLKHYACVIDMLGRAGQLDKALRVVAEEMSEEADVGIWKSLLSSCRIHQNLEMGEKVAAKLFELEPEK
PENYVLLSNLYAGLGKWEDVRKVRQRMNEMSLRKDAGCSWIELNRKVFSFVVGERFLDGFEEIKSLWSILEMKISKMGYR
PDTMSVQHDLSEEEKIEQLRGHSEKLALTYGLIKTSEGTTIRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFK
NGVCSCGDYW*

DNA
ATGGCTTCTGTTTTGCTTCCATTGCCACAAGTATTTGTTTTGTTTGATTATCGCAGGAGCCGTAAAGAGTCAAGCTTTCC
CCGCGCCGTCTACAATTCCAATTCCATTTCTTCTAATTCAACCAATGCCAATCATTTCCTTCGCCGGATTTCTAACTTCT
GTGAAACCGGAGACCTCGACAAGTCCTTTCGAACTGTCCAAGAATTCGTTGGCGATGACGAGAGCTCGTCCGATGCGTTT
CTTCTTGTCCGAGAAGCTCTTGGGCTTCTCTTACAAGCTTCTGGGAAGAGAAAAGACATTGAAATGGGAAGAAAGATCCA
CCAGCTGGTTTCTGGGTCGACCCGGTTAAGGAATGATGACGTTCTCTGTACTCGTATTATCACCATGTACGCTATGTGTG
GCTCTCCTGATGATTCTCGGTTTGTGTTTGATGCCTTGCGGAGTAAGAATCTCTTCCAGTGGAATGCTGTTATCAGCTCT
TACTCAAGAAACGAGCTTTACGATGAAGTATTAGAGACGTTTATCGAGATGATCTCAACGACTGATCTTTTACCGGATCA
TTTCACTTATCCATGTGTGATTAAGGCTTGTGCTGGGATGTCTGATGTTGGGATCGGGCTTGCGGTTCATGGGTTGGTGG
TGAAGACCGGATTGGTGGAAGATGTTTTTGTGGGTAATGCATTGGTGTCTTTCTATGGAACTCATGGTTTTGTTACTGAT
GCCTTGCAACTGTTCGATATAATGCCTGAGAGAAATTTGGTTTCCTGGAACTCCATGATTCGAGTGTTCTCGGATAATGG
TTTCTCAGAAGAAAGCTTCTTGCTTCTTGGAGAAATGATGGAGGAAAATGGTGATGGTGCGTTTATGCCGGATGTTGCTA
CACTTGTTACTGTGTTGCCGGTTTGTGCAAGAGAAAGAGAAATAGGGTTGGGAAAAGGTGTTCATGGGTGGGCGGTGAAA
TTGAGGTTGGACAAGGAACTAGTCCTTAACAATGCCTTAATGGACATGTACTCCAAATGCGGTTGCATTACTAATGCACA
AATGATCTTTAAGATGAACAATAACAAGAATGTGGTTTCTTGGAACACAATGGTAGGAGGTTTTTCAGCAGAGGGTGATA
CACATGGGACGTTTGATGTTCTGAGACAGATGCTGGCAGGAGGCGAAGATGTCAAAGCGGACGAGGTAACCATTCTAAAT
GCAGTGCCTGTTTGTTTCCATGAATCATTCTTACCGAGTTTAAAGGAACTTCATTGTTACTCCTTAAAACAAGAGTTTGT
ATACAATGAGTTAGTAGCCAATGCCTTTGTGGCTTCTTATGCAAAGTGTGGCTCACTGAGTTATGCCCAGCGTGTGTTTC
ATGGTATAAGGAGTAAAACAGTGAACTCTTGGAATGCTTTGATTGGCGGCCATGCTCAGAGCAATGATCCGAGATTGTCC
TTGGATGCTCATTTGCAGATGAAAATTTCTGGATTGCTACCTGATAGTTTTACTGTCTGTAGTCTTCTTTCAGCTTGTTC
TAAACTAAAATCCCTGCGGTTGGGAAAGGAAGTGCATGGGTTTATAATCCGAAATTGGTTAGAAAGAGATTTGTTTGTTT
ATTTATCAGTACTCTCATTATACATTCATTGTGGGGAGCTATGCACTGTACAAGCATTATTTGATGCAATGGAAGATAAA
AGCTTAGTATCTTGGAATACTGTAATCACCGGTTACCTTCAGAATGGATTTCCTGATAGAGCTTTGGGCGTCTTTAGACA
AATGGTTTTGTATGGAATCCAGCTTTGTGGGATTTCTATGATGCCTGTGTTTGGTGCGTGTTCGCTGCTACCTTCTCTTC
GACTGGGGAGAGAAGCGCATGCTTATGCTTTGAAGCACCTCCTGGAGGACGATGCGTTTATTGCATGTTCTTTAATTGAT
ATGTATGCCAAGAATGGTTCTATAACACAATCATCTAAGGTTTTCAATGGCTTGAAGGAGAAAAGCACGGCATCTTGGAA
TGCCATGATAATGGGATATGGAATACATGGCCTAGCAAAAGAGGCTATAAAACTCTTTGAAGAGATGCAAAGAACAGGTC
ATAACCCTGATGACCTAACTTTCTTAGGTGTTCTAACGGCTTGCAACCATAGTGGTCTGATCCATGAAGGGCTGAGATAT
CTGGATCAAATGAAGTCTTCTTTTGGGCTAAAGCCAAATTTAAAGCATTATGCTTGTGTCATTGACATGTTAGGCCGAGC
TGGGCAACTAGACAAGGCTCTAAGGGTTGTTGCAGAAGAGATGTCTGAGGAAGCTGACGTTGGAATTTGGAAGTCTCTGC
TCAGCTCATGCAGAATCCATCAAAATCTGGAAATGGGAGAGAAAGTTGCTGCTAAGTTATTCGAATTAGAACCAGAAAAG
CCTGAGAATTATGTTCTGCTTTCCAACTTATATGCAGGATTGGGGAAATGGGAAGACGTGAGAAAAGTGAGACAGAGAAT
GAACGAGATGAGTTTACGAAAGGATGCTGGATGCTCTTGGATCGAACTAAACAGGAAGGTATTTAGCTTTGTTGTCGGTG
AAAGATTCTTAGATGGTTTTGAGGAAATCAAAAGTCTTTGGAGTATATTGGAGATGAAGATATCGAAGATGGGATACAGA
CCAGACACAATGTCAGTACAACATGATCTAAGTGAAGAGGAGAAGATTGAACAGTTAAGGGGACACAGCGAGAAGCTTGC
CCTTACCTACGGGTTGATTAAAACTTCAGAAGGAACAACTATTAGAGTTTACAAGAACCTAAGGATCTGTGTGGACTGTC
ACAATGCAGCAAAGTTGATCTCCAAGGTCATGGAAAGGGAAATAGTTGTGAGGGACAACAAAAGGTTTCATCATTTCAAG
AATGGGGTTTGTTCTTGTGGAGATTACTGGTAA