Details for Arabidopsis Locus AT1G18460

Position : Chr1 ( 5`- 6352470 .. 6356113 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18460

Protein [Map View]
MQRIVDNALAITKESVKTLTYESLNNIARCINGFSALLLTLLPGKSNVLEGLHGWELRPTLRGPRLPRWMHNGVSSFNHF
IHELSVDSDTSSLDYSSGDDDSDGMSTPPSPLSQSSLRSWASLPANYESHWTDWITFIVWWALLPARILLWVPLYLLRLL
ARRNSRMQPLSPGRYQHSSRPCFSKAISGKEHDVPNRTTDKRRGVIEDLQLGIEIFIETIFDFFHKAAHLLLSPSETFGI
VLSWFSSSSHSSKGNYGDVSDDEIIQTAILGDNDSSLTERRTTTSLYNTDTRTCQDVITELGYPYEAIRVVTSDGYGLLL
ERIPRRDARKAVYLQHGVMDSSMGWVSNGVVGSPAFAAYDQGYDVFLGNFRGLVSRDHVKKNISSKDFWRYSINEHATED
IPAMIEKIHEIKTSELKLYQPTMEEVVNEDQPYKLCVVSHSLGGAAVLMYVITRKIEEKPHRLSRLILLSPAGFHYDSNM
CFTLMEYTFLFLGPVLSRIVPAFYIPTKFFRMLLNKLARDFHNYPAVGGLVQTLMSYVVGGDSSNWVGVMGLPHYNMNDM
PGISFRVAQHLAQIKHSGKFKMFDYGSSSANMDVYGSPEPLDLGEFYGLIDVPVDLVAGKKDKVIRPSMVRKHYRVMRDS
GVDVSYNEFEYAHLDFTFSHREELLAYVMSRLLLVEPTQTQTVHKKGMKLKKKMETGKPHL*

DNA
ATGCAGAGGATCGTCGATAATGCTCTTGCTATCACAAAAGAGTCAGTGAAAACTCTGACTTATGAGTCTTTGAACAACAT
TGCAAGATGCATTAATGGATTTTCTGCGCTTCTCTTGACACTTTTGCCCGGAAAGTCCAATGTTCTTGAAGGTCTTCATG
GATGGGAGCTTAGGCCTACATTGCGTGGACCTCGTTTACCACGCTGGATGCATAATGGAGTCTCTTCTTTCAACCACTTC
ATTCACGAACTCTCTGTGGATTCTGATACTTCTAGCTTGGACTATTCCTCTGGTGATGATGATAGTGATGGCATGTCCAC
GCCTCCATCACCCTTGTCTCAAAGCTCACTCCGCTCTTGGGCTAGTCTTCCTGCCAATTACGAAAGCCATTGGACAGACT
GGATAACCTTCATTGTCTGGTGGGCTTTACTACCTGCCCGGATCCTTCTATGGGTACCATTATATCTTTTACGTCTTTTA
GCTAGAAGAAATTCAAGAATGCAGCCTCTGAGCCCAGGAAGGTACCAACATTCGTCTAGACCTTGTTTTAGCAAAGCTAT
CTCAGGGAAAGAGCATGACGTGCCCAACCGAACTACTGATAAAAGACGCGGAGTCATTGAGGATCTTCAGCTTGGTATCG
AGATCTTTATAGAAACAATATTTGATTTCTTTCACAAGGCGGCACATCTTCTTCTTTCTCCATCAGAAACTTTTGGAATA
GTTTTATCATGGTTCTCTTCCTCCAGTCACAGCTCTAAAGGAAACTATGGTGACGTTTCGGATGATGAGATCATTCAGAC
TGCCATTCTAGGAGATAACGATTCATCTCTTACAGAAAGAAGAACCACAACGAGCTTATACAATACAGATACCCGGACCT
GTCAAGATGTTATAACAGAGCTTGGGTATCCATATGAAGCTATTCGTGTTGTTACATCTGATGGATATGGTCTTCTCTTG
GAAAGGATACCAAGACGAGATGCGAGGAAAGCTGTTTATTTGCAGCATGGTGTAATGGATTCTTCAATGGGATGGGTATC
AAATGGTGTTGTTGGATCACCAGCTTTTGCAGCTTATGATCAAGGCTACGATGTTTTCCTAGGGAACTTTCGTGGTTTAG
TTTCAAGAGATCATGTGAAAAAAAACATATCCTCAAAAGATTTCTGGCGTTACTCCATCAATGAACATGCAACGGAAGAT
ATCCCAGCAATGATAGAGAAGATTCACGAAATCAAAACTTCAGAACTGAAACTTTATCAGCCTACTATGGAAGAGGTAGT
AAACGAGGATCAACCGTATAAGCTTTGTGTTGTATCTCACAGTTTAGGCGGTGCCGCGGTTCTGATGTATGTAATCACCC
GTAAAATCGAAGAGAAACCGCACAGACTCTCGAGACTGATCCTTCTTTCGCCTGCTGGGTTTCACTATGACTCCAACATG
TGTTTCACGTTGATGGAGTACACGTTCCTTTTCTTGGGTCCTGTACTATCTCGGATTGTTCCTGCTTTCTACATCCCCAC
TAAATTCTTCCGGATGCTTCTCAACAAGTTAGCTCGAGATTTCCATAACTATCCTGCTGTTGGTGGATTAGTCCAAACAT
TGATGAGTTATGTAGTTGGCGGAGATAGCTCAAACTGGGTTGGAGTCATGGGATTGCCTCACTATAACATGAACGATATG
CCAGGTATATCCTTCCGTGTGGCTCAGCATCTTGCACAGATTAAACATAGCGGTAAGTTCAAGATGTTTGATTACGGTAG
CAGTTCAGCTAATATGGATGTTTACGGGTCCCCTGAGCCGCTCGATCTTGGGGAGTTTTATGGGTTGATCGATGTGCCTG
TGGATTTAGTAGCTGGAAAGAAAGACAAAGTGATTAGACCTTCAATGGTTAGGAAACATTACAGGGTGATGAGAGATTCA
GGAGTAGATGTTTCTTACAATGAGTTTGAGTATGCTCATTTGGATTTTACCTTCTCTCACCGTGAAGAGCTTTTGGCGTA
TGTGATGTCGCGGTTACTTCTCGTGGAGCCAACGCAGACTCAGACGGTTCATAAGAAGGGGATGAAGCTGAAGAAGAAAA
TGGAAACAGGCAAACCTCATCTGTGA