Details for Arabidopsis Locus AT1G18450

Position : Chr1 ( 5`- 6348107 .. 6351975 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18450

Protein [Map View]
MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKTESEKEKSKRKLYVGSQ
AMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKVPALFMAK
NPVLTSFATGRATSLVVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKGIKIRPRYSFKRKEVRAGEF
QVEDVDIPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRFKVPDVMFNPSIVQT
IPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTE
RRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKCP*

DNA
ATGTACGGCGGAGATGAAGTGTCAGCTATTGTGGTTGACTTGGGTTCGCACACTTGCAAGGCTGGTTACGCCGGTGAAGA
TGCTCCCAAGGCCGTTTTCCCTTCCGTTATTGGGGCAGTAGATGGTGTAGAGGCAATGGATGTGGATGTTGATTCTACAA
AGACTAATTCGAACTCTGAGGATTCGAAGACCGAGTCTGAAAAGGAAAAGAGCAAACGCAAGCTCTATGTAGGATCTCAA
GCCATGAGCTACCGCAGAGATCATATGGAGGTTTTGTCACCTATAAAAGATGGCATCGTTTCTGACTGGGATTTGGTGGA
CAATATATGGGAACATGCTTTCAAGAGTTGTCTGATGATTGATCCTACGGAGCATCCAATGCTGCTAGCTGAGCCTCCTT
TAAACACTCAACAGCAGAGAGAGAAGGCGGCAGAGCTAATGTTTGAAAAGTACAAAGTTCCGGCACTGTTTATGGCTAAG
AACCCTGTTCTCACGTCTTTTGCTACTGGGCGTGCTACTTCTTTGGTTGTTGACTGCGGTGGAGGATCCACAACCATTTC
ACCGGTGCATGATGGTTATGTTCTTCAGAAGGCTGTTGTATCGTCTCCACTTGGAGGGGAATTTCTCACTGACTGCCTAC
TGAAAAGCTTGGAGAGTAAAGGAATTAAAATAAGACCTAGATACTCTTTCAAGAGGAAGGAAGTACGAGCAGGGGAATTC
CAGGTTGAAGATGTGGATATTCCTGACACCACGGAAAGCTACAAACTCTTCTGCCAGAGGATGATAGTGGGTGATATCAA
GGATTCCATTTGTCGAGTTCCTGATACTCCCTATGACGATAAATCATATTCAAACATCCCTACTACGTCGTACGAGCTTC
CTGATGGCCAGACGCTCGAGATTGGTGCTGATAGGTTCAAAGTTCCTGATGTGATGTTCAACCCGTCCATAGTCCAGACG
ATTCCTGGAATGGAGAAGTATGCTGAGATGATTCCTTCCGTTCGTGGGTTACCACACATGGTCATGGAGAGCATCAACAA
ATGTGATGTAGACATCCGGAGAGAGTTGTATAGTAGCATACTGCTTGCTGGTGGCACATCGTCAATGCAACAGCTGAAAG
AACGTCTCGAAAAGGACTTGATCGAAGAGTCTCCTCACTCAGCTAGAGTTAAAGTGTTGGCAAGCGGTAACACAACAGAA
AGAAGATTCAGTGTATGGATAGGAGGGAGTATATTGGCATCACTAGGCTCATTTCAACAGATGTGGTTCTCCAAGTCTGA
GTATGAGGAACATGGAGCTTCCTACATTCAGAGAAAATGCCCTTAA