Details for Arabidopsis Locus AT1G18350

Position : Chr1 ( 5`- 6315651 .. 6316738 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18350

Protein [Map View]
MALVRKRRQINLRLPVPPLSVHLPWFSFASSTAPVINNGISASDVEKLHVLGRGSSGIVYKVHHKTTGEIYALKSVNGDM
SPAFTRQLAREMEILRRTDSPYVVRCQGIFEKPIVGEVSILMEYMDGGNLESLRGAVTEKQLAGFSRQILKGLSYLHSLK
IVHRDIKPANLLLNSRNEVKIADFGVSKIITRSLDYCNSYVGTCAYMSPERFDSAAGENSDVYAGDIWSFGVMILELFVG
HFPLLPQGQRPDWATLMCVVCFGEPPRAPEGCSDEFRSFVDCCLRKESSERWTASQLLGHPFLRESL*

DNA
ATGGCTCTTGTTCGTAAACGCCGTCAAATCAACCTCCGTCTCCCTGTCCCACCGCTCTCTGTTCACCTCCCCTGGTTCTC
CTTTGCCTCATCCACCGCCCCCGTCATCAACAACGGAATCTCAGCTTCCGATGTCGAGAAACTCCACGTTCTCGGAAGAG
GAAGCAGCGGGATCGTATACAAAGTCCACCACAAAACCACGGGGGAGATATACGCTCTGAAATCAGTCAACGGCGACATG
AGTCCTGCTTTCACAAGACAATTAGCGCGCGAGATGGAGATCCTCCGTCGCACGGATTCTCCTTATGTCGTCAGGTGTCA
AGGGATCTTCGAGAAACCAATCGTCGGAGAGGTTTCGATCCTCATGGAGTATATGGACGGTGGAAACCTAGAATCTCTCC
GCGGCGCCGTTACGGAGAAACAACTAGCGGGATTTTCCCGCCAGATTTTGAAAGGTTTAAGTTATCTCCACTCACTCAAG
ATCGTTCACAGAGACATCAAACCTGCGAATCTACTCTTAAACTCGAGAAACGAAGTTAAAATCGCTGATTTTGGAGTGAG
CAAAATCATTACCCGATCGTTAGATTACTGCAATTCCTACGTCGGCACTTGCGCTTACATGAGCCCGGAGAGATTTGACT
CTGCCGCCGGAGAAAACTCCGATGTTTACGCAGGCGATATCTGGAGTTTCGGAGTGATGATACTTGAGCTCTTCGTCGGA
CATTTTCCGTTGCTTCCTCAGGGACAGAGACCTGACTGGGCGACGTTAATGTGCGTCGTGTGCTTTGGAGAACCACCGCG
TGCGCCGGAAGGATGTTCCGACGAGTTTAGGAGTTTTGTTGACTGTTGTCTCCGTAAAGAATCGAGTGAGAGGTGGACGG
CGTCGCAGCTTCTCGGTCACCCTTTTCTCCGTGAAAGTCTTTAG