Details for Arabidopsis Locus AT1G18290

Position : Chr1 ( 5`- 6297364 .. 6298328 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18290

Protein [Map View]
MGNTSSCAPLIISTNSSSGVVKILAPFTGTLEVFSKPIKTSDIVSRHSGHFITDSTLLQISHRVTAVSPDEYLRPRRHLY
LLLPTDMLFSVLTQEELSLISNKAAETLNKSRYNHLKRIFPVCIFPMTGDRRRNPSSVNEDRAHDGVEIRETLDEKVLYE
SKHGSWRPKLETIVES*

DNA
ATGGGAAACACATCTTCATGCGCACCATTGATCATATCAACAAACTCATCCTCAGGAGTGGTTAAAATCTTGGCTCCATT
CACCGGAACTCTTGAAGTTTTCTCAAAACCCATCAAAACCTCCGACATCGTCTCTAGACACTCCGGCCACTTTATTACCG
ACTCAACTTTACTCCAAATCAGCCACCGAGTCACCGCCGTGTCTCCCGACGAATATTTACGGCCGAGACGACATCTCTAC
CTCCTCCTCCCGACCGACATGCTCTTCTCTGTCTTAACACAAGAAGAACTTTCTCTCATCTCCAACAAAGCCGCGGAGAC
ACTCAACAAAAGCCGGTATAACCATTTGAAGAGAATATTCCCGGTCTGCATATTTCCGATGACCGGAGACAGAAGAAGAA
ACCCATCATCAGTTAATGAAGATCGAGCTCATGATGGTGTGGAAATAAGAGAAACCCTAGATGAGAAGGTACTATACGAA
TCAAAACATGGATCTTGGAGGCCTAAATTGGAGACGATCGTGGAGAGCTAA