Details for Arabidopsis Locus AT1G18280

Position : Chr1 ( 5`- 6294333 .. 6295364 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18280

Protein [Map View]
MEAVRFAVAVVLVFCYVTSSNAQMTSPPSGGAGGDAHSLPCIQKLMPCQPYLHLATPPPATCCMPLNEIVAKDATCLCAV
FNNVDMLKSLNLTKENALDLPKACGAKADVSLCKTSAGTNSSSTPPATPKTPPASSTSTGTGSGSTGNAAPSTAKPTSSA
PAINFGGLSFASAVVATLFF*

DNA
ATGGAGGCTGTTAGATTCGCCGTCGCCGTCGTTCTTGTATTTTGCTACGTTACGTCGTCTAATGCTCAGATGACTTCACC
ACCGAGCGGCGGTGCAGGAGGAGACGCACACTCACTGCCGTGTATTCAGAAACTGATGCCGTGTCAGCCGTATCTTCACT
TGGCGACTCCGCCGCCGGCGACGTGTTGCATGCCGTTGAATGAGATCGTAGCCAAAGACGCCACGTGTCTCTGCGCTGTC
TTTAACAACGTTGATATGCTCAAATCGCTTAACCTCACTAAAGAAAACGCTCTCGATCTCCCCAAGGCTTGTGGCGCCAA
AGCTGACGTGTCACTATGCAAAACCAGCGCCGGTACTAATTCGTCTTCAACACCGCCGGCAACCCCGAAAACTCCTCCGG
CATCTTCCACCAGTACCGGAACAGGAAGCGGATCAACCGGAAATGCAGCTCCTTCGACGGCCAAGCCAACAAGCTCAGCC
CCGGCCATCAACTTCGGTGGACTTAGCTTTGCATCGGCTGTCGTGGCAACACTCTTCTTCTGA