Details for Arabidopsis Locus AT1G18270

Position : Chr1 ( 5`- 6283412 .. 6293871 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18270

Protein [Map View]
MSGVVGFVGLDSFSFELASSLLRSGFKVQAFEISTELVEKFIELGGHKCDSPADVGKAAAAVVVVLSHPDQIQDVIFGDE
GVMKGLQKDAVLLLSSTISTLQLQKLEKQLTEKREQIFVVDAYVLKGMSELLDGKLMIIASGRSDSITRAQPYLTAMCQN
LYTFEGEIGAGSKVKMVNELLEGIHLVAAVEAISLGSQAGVHPWILYDIISNAAGNSWIYKNHIPLLLKDDIEGRFLDVL
SQNLAIVEDKAKSLPFPVPLLAVARQQLISGISQMQGDDTATSLAKISEKVLGVGILEAANRELYKPEDLAKEITTQAKP
VNRIGFIGLGAMGFGMAAHLLKSNFSVCGYDVYKPTLVRFENAGGLAANSPAEVTKDVDVLVIMVTNEVQAEDVLYGHLG
AVEAIPSGATVVLASTVSPAFVSQLERRLENEGKDLKLVDAPVSGGVKRAAMGELTIMASGTDEALKSAGLVLSALSEKL
YVIKGGCGAGSGVKMVNQLLAGVHIASAAEAMAFGARLGLNTRKLFNVISNSGGTSWMFENRVPHMLDNDYTPYSALDIF
VKDLGIVTREGSSRKVPLHISTVAHQLFLAGSAAGWGRIDDAGVVKVYETLAGIKVEGRLPVLKKQDLLKSLPAEWPSDP
TTDIHRLNMGNSKTLVVLDDDPTGTQTVHDVEVLTEWSVESISEQFRKKPACFFILTNSRSLSPEKASELIKDICSNLCA
ASKEVGNADYTIVLRGDSTLRGHFPQEADAAVSILGEMDAWIICPFFLQGGRYTIDDVHYVADSDRLVPAGETEFAKDAS
FGYKSSNLREWVEEKTAGVIPANSVQSISIQLLRKGGPDAVCEFLCSLKKVNFSKQISRRLLDVAFRELLGSTCIVNAAS
ERDMAVFAAGMIQAELKGRSFLCRTAASFVSALIGIIPKDPVLPKDFESNKESSGALIVVGSYVPKTTKQVEELQSQHNQ
NLRSIEISVEKVALKSSEVRDEEIRRAVEMADAFLRAGRETLIMSSRELITGKTSSESLDINSKVSSALVEVVSQISTRP
RYILAKGGITSSDTATKALKARRALVIGQALAGVPVWKLGPESRHPGVPYIVFPGNVGNSTALAEVVKSWSVVAGRSTKE
LLLNAEKGGYAVGAFNVYNLEGIEAVVAAAEEENSPAILQVHPGAFKQGGIPLVSCCISAAEQARVPISVHFDHGTTKHE
LLEALELGLDSVMVDGSHLSFTENLSYTKSITELARSKNIMVEAELGRLSGTEDGLTVEDYEAKLTNVNQAQEFMETGID
ALAVCIGNVHGKYPKSGPNLKLDLLKELHALSSKKGVFLVLHGASGLSENLIKECIENGVRKFNVNTEVRTAYMEALSSG
KKTDIVDVMSATKAAMKAVIADKIRLFGSAGKA*

DNA
ATGAGTGGCGTGGTTGGGTTTGTTGGTCTTGATTCTTTCAGCTTCGAATTAGCTTCTTCGCTTCTTCGTTCTGGGTTTAA
GGTTCAAGCATTCGAGATAAGTACAGAATTAGTGGAGAAGTTCATTGAATTGGGAGGACACAAATGTGACAGCCCTGCAG
ATGTTGGGAAAGCTGCAGCAGCCGTTGTGGTTGTACTATCCCACCCTGACCAAATTCAAGATGTCATTTTTGGTGATGAG
GGTGTTATGAAAGGTCTACAGAAGGACGCTGTATTGCTTTTGTCTTCGACAATATCGACTTTGCAACTCCAGAAACTAGA
GAAACAACTTACAGAGAAAAGAGAGCAGATTTTTGTAGTTGATGCCTATGTTTTAAAAGGGATGTCTGAGCTTCTTGATG
GAAAACTAATGATAATAGCATCTGGAAGGTCAGATTCGATCACAAGAGCACAACCCTATCTTACTGCAATGTGTCAAAAT
CTGTACACCTTTGAGGGAGAAATTGGTGCTGGAAGTAAAGTTAAAATGGTGAATGAGTTGCTTGAGGGCATACATCTTGT
TGCTGCTGTGGAGGCTATATCTTTAGGTTCTCAGGCGGGTGTGCATCCATGGATACTTTATGACATAATTTCCAATGCTG
CTGGAAATTCATGGATTTACAAGAATCATATTCCGTTGTTGCTAAAAGATGACATAGAGGGTCGCTTCCTCGATGTTCTC
TCTCAGAATCTGGCCATTGTTGAAGATAAAGCCAAATCGCTCCCATTTCCTGTCCCACTTTTGGCAGTTGCACGCCAACA
ACTAATCTCTGGAATATCACAGATGCAGGGAGATGATACAGCTACTTCATTGGCTAAGATCTCGGAAAAAGTACTTGGTG
TTGGCATATTAGAAGCAGCCAATAGAGAACTTTATAAGCCAGAGGATTTGGCCAAAGAAATTACTACTCAAGCAAAGCCT
GTGAATAGAATTGGTTTTATTGGTCTTGGAGCAATGGGTTTTGGCATGGCAGCACACCTGTTGAAATCAAATTTTTCTGT
CTGTGGTTATGACGTATACAAGCCAACACTTGTCAGATTTGAGAATGCCGGGGGATTGGCGGCAAATTCTCCAGCTGAAG
TGACGAAAGATGTAGATGTTCTTGTAATTATGGTAACAAACGAGGTTCAGGCTGAGGATGTCTTGTATGGACATCTTGGA
GCGGTTGAAGCTATACCATCTGGAGCAACTGTTGTACTTGCGTCAACAGTATCTCCCGCGTTTGTTAGCCAACTTGAAAG
GCGTCTAGAAAATGAGGGAAAAGACCTAAAGCTAGTTGATGCTCCTGTGTCTGGTGGTGTCAAGAGGGCTGCCATGGGGG
AGCTTACGATAATGGCTTCAGGTACCGATGAAGCACTTAAGTCTGCGGGACTTGTGTTATCAGCATTAAGTGAGAAGCTC
TACGTGATTAAAGGAGGTTGTGGGGCAGGAAGTGGTGTAAAAATGGTCAATCAATTGCTTGCGGGAGTTCATATCGCATC
AGCTGCCGAGGCAATGGCATTTGGAGCTCGGTTAGGTCTGAATACTCGAAAGCTATTCAATGTTATTTCCAACAGCGGTG
GAACATCTTGGATGTTTGAAAATCGTGTTCCGCACATGCTGGATAATGATTACACACCATACTCTGCTCTTGATATTTTT
GTCAAGGATTTGGGAATTGTTACCCGAGAAGGTTCATCCCGTAAAGTTCCACTCCATATATCAACAGTGGCACACCAGCT
ATTCTTAGCCGGCTCTGCTGCGGGCTGGGGACGGATAGATGATGCTGGAGTGGTGAAGGTTTATGAAACCCTTGCTGGAA
TTAAAGTCGAAGGGAGACTTCCTGTTCTGAAGAAACAAGACCTACTGAAATCTCTTCCAGCTGAATGGCCTTCAGACCCT
ACAACTGACATACATAGACTAAATATGGGAAACTCGAAGACATTGGTTGTTCTTGATGATGATCCAACTGGCACACAAAC
TGTTCATGACGTAGAGGTTTTAACTGAATGGAGTGTTGAATCTATTTCTGAGCAGTTTAGAAAAAAGCCTGCATGCTTCT
TCATTTTGACAAATTCAAGGTCCCTGAGCCCTGAGAAGGCTAGTGAATTGATCAAAGACATCTGTTCCAACCTATGTGCT
GCATCAAAAGAAGTTGGCAATGCTGACTACACGATTGTTCTGAGGGGTGATTCAACATTACGTGGTCATTTTCCTCAGGA
AGCAGATGCTGCTGTCTCAATACTTGGGGAAATGGATGCATGGATTATTTGCCCCTTCTTCCTTCAAGGGGGACGTTATA
CTATTGATGATGTGCATTATGTTGCGGATTCTGATAGGCTCGTTCCTGCAGGAGAGACAGAGTTTGCCAAAGATGCATCC
TTTGGATATAAATCCTCAAATCTCCGTGAGTGGGTTGAGGAGAAAACAGCTGGCGTCATTCCGGCTAACAGCGTTCAGTC
GATCTCAATTCAGCTTTTAAGAAAAGGTGGCCCTGATGCAGTGTGTGAGTTTCTGTGCAGTTTAAAGAAGGTAAATTTTT
CTAAGCAGATTTCGCGACGACTTCTGGATGTTGCTTTCCGTGAACTTTTGGGGTCTACATGTATTGTCAACGCCGCTAGT
GAAAGAGACATGGCTGTATTTGCAGCCGGGATGATCCAGGCAGAACTGAAAGGGAGATCCTTTTTATGCCGCACTGCTGC
TAGCTTTGTGTCTGCTCTAATAGGGATTATTCCAAAAGATCCTGTGTTGCCAAAAGATTTCGAATCTAACAAAGAAAGCA
GTGGTGCACTAATAGTTGTAGGCTCATATGTCCCGAAAACAACAAAGCAGGTTGAAGAACTTCAATCACAACATAACCAG
AATTTAAGGAGCATCGAGATCTCTGTAGAAAAAGTTGCTCTCAAGTCATCTGAAGTGAGAGATGAAGAAATCAGAAGAGC
AGTTGAGATGGCCGATGCTTTCCTTCGGGCTGGCAGGGAGACTCTAATTATGAGCAGTCGTGAACTCATCACGGGAAAAA
CATCTTCGGAAAGTCTTGATATTAACAGCAAAGTGAGCTCCGCTCTGGTTGAAGTAGTGAGCCAGATATCGACCAGACCT
CGTTATATTCTTGCTAAGGGTGGAATTACGTCATCAGACACAGCAACGAAAGCCCTGAAAGCACGACGTGCACTTGTGAT
TGGTCAAGCCCTTGCTGGTGTTCCAGTATGGAAGTTAGGTCCAGAAAGTAGACATCCAGGGGTCCCCTACATTGTTTTCC
CTGGTAATGTTGGTAACAGCACAGCGCTTGCAGAAGTTGTGAAGTCTTGGTCAGTGGTAGCAGGACGGTCGACAAAAGAG
CTGCTTCTGAATGCAGAAAAAGGTGGATATGCAGTTGGAGCATTTAACGTGTATAACCTGGAAGGAATAGAAGCTGTTGT
AGCGGCCGCAGAGGAAGAAAATAGTCCTGCTATATTGCAGGTCCATCCAGGTGCCTTTAAACAAGGAGGCATTCCTTTGG
TTTCATGTTGCATCTCTGCAGCTGAACAAGCCAGGGTTCCAATATCCGTACACTTTGATCATGGAACTACAAAGCATGAG
CTATTAGAAGCTCTTGAGCTAGGACTAGATTCAGTGATGGTAGATGGTTCTCATCTTTCCTTCACAGAAAATTTATCCTA
CACGAAATCCATAACAGAGTTGGCCCGTTCCAAAAACATTATGGTGGAAGCTGAACTAGGCCGACTCTCAGGAACAGAGG
ATGGCTTGACTGTTGAAGACTATGAAGCAAAGCTCACCAACGTTAACCAGGCTCAGGAATTTATGGAAACTGGTATAGAT
GCTTTGGCTGTGTGTATAGGAAATGTCCATGGAAAGTACCCCAAGTCCGGTCCAAACCTCAAGCTTGATTTACTTAAGGA
ACTGCACGCCTTAAGCTCGAAGAAAGGCGTTTTTCTTGTTCTTCACGGAGCTTCTGGTTTGTCTGAGAACCTTATCAAGG
AATGCATTGAGAATGGAGTGAGGAAGTTCAACGTGAACACAGAAGTAAGAACGGCTTACATGGAAGCTCTTAGCTCTGGG
AAGAAGACCGACATTGTTGATGTCATGTCCGCAACAAAAGCAGCCATGAAAGCTGTGATCGCAGATAAGATCCGTCTCTT
TGGCTCTGCCGGAAAAGCTTGA