Details for Arabidopsis Locus AT1G18265

Position : Chr1 ( 5`- 6282252 .. 6283293 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18265

Protein [Map View]
MDVYFFVMEITSFLKLLSQTDGFGFGIFVIGCSSQFFNLVFLCCLLLLGLKFLSFKGTSLFLQYLEKINRISPNIEFFNS
FNREHKDCNNNNNNNNNNNGFISKSHLADGLDQKKPIILHWSSDSTNRLSWENCDLLLLRDGLDHIQNRENTVALSETEL
DEKNHHGEEEESEDEEESQSQNDEDQLLDVITLRTMVKRERKRGDYMKKELEKERRAAESAAEEAMAMLLKLRMEKSVVE
METKQYKRVAEQKQVYDQEVIQSLQWMLMKLDDDEDKIQM*

DNA
ATGGATGTATACTTCTTTGTAATGGAGATTACTTCATTTCTGAAGCTTTTGAGTCAAACTGATGGTTTTGGATTTGGGAT
CTTCGTTATTGGTTGCTCCTCTCAGTTTTTCAATCTCGTCTTTCTCTGTTGTTTGCTTCTTTTGGGACTAAAGTTTCTAT
CTTTCAAAGGTACTTCATTGTTTTTGCAGTATTTAGAGAAGATCAATCGAATTTCTCCGAACATTGAGTTTTTCAATTCC
TTCAATCGAGAACACAAGGATTGCAACAACAACAACAACAACAACAACAACAACAATGGGTTCATTTCAAAATCTCATTT
GGCTGATGGATTGGATCAGAAGAAACCAATCATTTTACACTGGAGTTCTGATTCTACTAATAGATTGAGCTGGGAGAACT
GTGATCTTCTCCTTCTACGTGATGGGCTTGATCACATCCAGAACAGAGAAAATACCGTGGCGTTATCGGAGACAGAGCTC
GACGAGAAGAATCATCATGGCGAAGAAGAGGAAAGCGAGGACGAAGAAGAATCACAGTCTCAGAATGATGAAGACCAATT
GTTAGACGTTATTACTCTGAGAACAATGGTGAAGAGAGAGAGAAAACGTGGAGATTACATGAAGAAAGAGCTGGAGAAGG
AGAGAAGAGCAGCTGAATCAGCTGCTGAAGAAGCCATGGCTATGCTTCTGAAGCTACGGATGGAGAAAAGCGTTGTGGAG
ATGGAGACAAAACAATACAAGAGAGTCGCCGAACAGAAGCAAGTGTACGATCAAGAAGTGATTCAATCATTACAGTGGAT
GTTGATGAAGCTTGATGATGACGAAGACAAGATTCAAATGTAA