Details for Arabidopsis Locus AT1G18260

Position : Chr1 ( 5`- 6278848 .. 6282103 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18260

Protein [Map View]
MRILSYGIVILSLLVFSFIEFGVHARPVVLVLSNDDLNSGGDDNGVGESSDFDEFGESEPKSEEELDPGSWRSIFEPDDS
TVQAASPQYYSGLKKILSAASEGNFRLMEEAVDEIEAASSAGDPHAQSIMGFVYGIGMMREKSKSKSFLHHNFAAAGGNM
QSKMALAFTYLRQDMHDKAVQLYAELAETAVNSFLISKDSPVVEPTRIHSGTEENKGALRKSRGEEDEDFQILEYQAQKG
NANAMYKIGLFYYFGLRGLRRDHTKALHWFLKAVDKGEPRSMELLGEIYARGAGVERNYTKALEWLTLAAKEGLYSAFNG
IGYLYVKGYGVDKKNYTKAREYFEKAVDNEDPSGHYNLGVLYLKGIGVNRDVRQATKYFFVAANAGQPKAFYQLAKMFHT
GVGLKKNLEMATSFYKLVAERGPWSSLSRWALEAYLKGDVGKALILYSRMAEMGYEVAQSNAAWILDKYGERSMCMGVSG
FCTDKERHERAHSLWWRASEQGNEHAALLIGDAYYYGRGTERDFVRAAEAYMHAKSQSNAQAMFNLGYMHEHGQGLPFDL
HLAKRYYDESLQSDAAARLPVTLALASLWLRRNYADTVLVRVVDSLPEVYPKVETWIENVVFEEGNATILTLFVCLITIL
YLRERQRRQVVVVADPVAADVAQPLDADVAQHLAAFPR*

DNA
ATGAGAATATTAAGCTACGGAATCGTTATTCTCTCTTTACTCGTTTTCTCTTTCATTGAATTTGGCGTTCACGCTCGTCC
CGTCGTTCTCGTCCTCTCAAATGACGATCTCAATAGCGGCGGCGATGATAACGGAGTCGGAGAGTCCTCTGACTTCGATG
AGTTTGGAGAATCCGAACCTAAGTCCGAAGAGGAGCTTGATCCCGGTTCATGGCGATCGATCTTCGAGCCAGATGACTCA
ACAGTCCAAGCAGCCTCGCCGCAGTACTACTCCGGCCTCAAAAAGATTCTATCGGCGGCGAGTGAGGGAAATTTCAGGTT
GATGGAAGAAGCAGTGGATGAGATAGAGGCTGCTTCTTCAGCTGGAGATCCACACGCACAGTCGATAATGGGGTTCGTTT
ACGGGATAGGAATGATGCGAGAGAAGAGCAAAAGCAAGTCGTTTCTTCACCATAATTTCGCAGCTGCTGGTGGGAATATG
CAGTCGAAGATGGCACTTGCGTTCACGTATCTTCGTCAAGATATGCATGATAAAGCTGTTCAATTATATGCTGAATTAGC
AGAGACAGCTGTCAATAGTTTTCTGATCTCAAAGGATTCTCCGGTGGTTGAACCAACTAGAATTCATAGCGGAACTGAAG
AGAACAAAGGTGCTCTAAGGAAATCTCGAGGCGAGGAGGATGAAGATTTCCAGATATTGGAATATCAGGCACAGAAAGGG
AATGCTAATGCAATGTACAAAATTGGACTGTTCTACTACTTTGGCCTGCGAGGATTAAGGCGTGATCACACCAAGGCATT
GCATTGGTTTTTGAAAGCAGTAGATAAAGGAGAGCCGAGGTCAATGGAACTTCTGGGGGAGATATATGCTAGAGGAGCTG
GTGTTGAAAGAAATTATACCAAGGCACTTGAATGGCTTACACTTGCTGCAAAAGAAGGTCTCTATTCAGCATTTAATGGA
ATTGGCTACTTGTATGTCAAAGGCTATGGAGTAGATAAGAAAAACTATACTAAGGCAAGAGAATATTTTGAGAAGGCTGT
TGACAATGAAGACCCCAGTGGGCATTATAACCTTGGAGTTTTGTATCTTAAAGGCATCGGAGTCAACAGGGATGTGAGGC
AGGCAACAAAATACTTCTTTGTTGCTGCAAATGCTGGTCAACCAAAGGCTTTCTATCAACTCGCCAAGATGTTCCATACT
GGTGTTGGGCTTAAGAAGAATCTGGAGATGGCGACTTCATTTTATAAGCTAGTAGCAGAAAGGGGGCCGTGGAGTTCTCT
CTCTAGATGGGCTCTTGAAGCTTACTTAAAAGGTGATGTGGGTAAGGCTTTGATTTTGTACTCAAGGATGGCAGAGATGG
GTTATGAAGTGGCACAAAGTAATGCTGCCTGGATCCTCGATAAATACGGCGAAAGAAGCATGTGCATGGGAGTATCTGGA
TTTTGCACAGACAAAGAGAGACATGAGCGGGCACATTCTTTGTGGTGGCGGGCCTCTGAACAAGGCAATGAACATGCTGC
TCTGCTTATTGGAGATGCATATTACTATGGCCGGGGAACTGAGAGAGATTTTGTGCGTGCGGCAGAAGCATACATGCATG
CTAAATCACAGTCCAATGCGCAAGCAATGTTCAACCTCGGTTACATGCATGAACATGGACAAGGACTTCCCTTTGATCTC
CATTTAGCAAAACGTTACTATGATGAATCCCTTCAGAGCGATGCAGCCGCGAGATTGCCAGTCACACTTGCTCTCGCTAG
CTTATGGCTCCGTAGAAACTATGCTGATACCGTCCTGGTGAGAGTTGTGGATTCATTACCAGAAGTGTATCCGAAGGTAG
AGACTTGGATAGAGAATGTGGTGTTTGAAGAAGGTAATGCAACAATACTTACACTCTTTGTCTGTCTCATCACAATTCTC
TATCTCCGGGAAAGACAACGTAGACAAGTCGTCGTTGTTGCCGATCCAGTGGCTGCTGACGTGGCACAACCGCTCGACGC
TGATGTGGCGCAACACCTCGCTGCGTTCCCACGGTAA