Details for Arabidopsis Locus AT1G18250

Position : Chr1 ( 5`- 6276788 .. 6278150 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18250

Protein [Map View]
MASINLFLFAFLLLLSHASAASTVIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAHSLQLPPLWSGRFWGRHGCTF
DRSGRGHCATGDCGGSLSCNGAGGEPPATLAEITLGPELDFYDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPV
GLQVRSRNGKRVVACKSACSAFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCP
HHRH*

DNA
ATGGCTTCAATCAACCTCTTCCTCTTCGCTTTCCTTCTTCTTCTCTCTCACGCTTCAGCAGCTTCAACGGTAATCTTCTA
CAACAAATGCAAACACCCAGTTTGGCCAGGTATCCAACCCAGCGCCGGTCAAAACTTACTCGCCGGCGGTGGTTTTAAGC
TTCCAGCTAACAAAGCCCACTCTCTTCAACTCCCACCACTCTGGTCCGGCCGTTTCTGGGGTCGCCACGGCTGCACCTTC
GACAGATCTGGCCGTGGTCACTGCGCCACCGGAGATTGCGGCGGTTCTCTCTCCTGCAACGGTGCCGGCGGTGAACCTCC
GGCCACTCTCGCCGAAATCACTCTCGGCCCTGAGCTAGACTTCTATGACGTCAGCCTCGTCGACGGTTATAACCTGGCCA
TGTCGATTATGCCGGTTAAAGGTTCAGGTCAATGTAGCTACGCCGGTTGTGTTAGCGATCTAAACCAGATGTGTCCGGTT
GGTTTACAAGTCCGGTCACGTAACGGGAAACGTGTAGTAGCCTGTAAAAGTGCTTGCTCTGCCTTCAATTCACCACAGTA
CTGTTGCACCGGCTTGTTCGGTAACCCACAGTCTTGCAAACCAACGGCTTACTCCAAAATCTTCAAAGTCGCTTGCCCAA
AAGCTTACTCTTATGCTTACGACGACCCAACCAGTATCGCCACATGTTCCAAGGCTAACTACATCGTCACCTTTTGCCCT
CATCATCGCCATTAA