Details for Arabidopsis Locus AT1G18210

Position : Chr1 ( 5`- 6266609 .. 6268828 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18210

Protein [Map View]
MASANPETAKPTPATVDMANPEELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDEF
STLCRSSSSAAEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMTSSSLLN
SNGSAAPPST*

DNA
ATGGCAAGCGCGAATCCAGAAACCGCCAAACCCACGCCTGCAACGGTGGACATGGCTAATCCAGAGGAGCTTAAGAAAGT
TTTCGACCAGTTTGACTCCAACGGCGACGGCAAGATCTCAGTCCTCGAACTCGGCGGTGTGTTTAAGGCTATGGGGACTT
CCTACACAGAGACGGAACTCAACCGCGTGCTCGAAGAAGTCGATACAGATCGCGACGGTTACATCAACCTCGACGAATTC
TCAACTCTCTGTCGCTCGTCTTCCTCCGCCGCAGAGATCCGTGACGCTTTCGATCTCTACGATCAGGACAAAAACGGACT
GATCTCCGCCTCTGAGCTTCACCAGGTGCTTAACCGTCTCGGGATGTCTTGCTCTGTTGAAGACTGTACTCGTATGATCG
GACCTGTGGATGCTGACGGCGATGGGAATGTTAATTTCGAAGAGTTTCAGAAGATGATGACGTCGTCTTCTCTCCTCAAC
AGCAATGGATCCGCCGCTCCTCCTTCGACCTAG