Details for Arabidopsis Locus AT1G18170

Position : Chr1 ( 5`- 6254229 .. 6255690 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18170

Protein [Map View]
MANLFTATAPFLSLSKPFTKTASYHQCYASSSNPPEPESSSPPPPPPPPQPLASQQKRKKNVETTDWVASSLTRRFGIGA
GLAWAGFLAFGVISEQIKTRIEVSQEVANTRDVEEEKEIVLPNGIRYYDQRVGGGATPRAGDLVVIDLKGQVQGTGQVFV
DTFGTKDKKKMKPLALVVGSKPYSKGLCEGIDYVLRSMKAGGKRRVIVPPSLGFGVDGAELESGLQIPPNASLEYIVEID
RVSIAPA*

DNA
ATGGCGAATCTGTTCACTGCTACGGCTCCTTTCCTCTCACTCTCGAAGCCATTCACCAAAACGGCATCGTACCACCAGTG
TTACGCCTCTTCTTCCAATCCGCCGGAGCCTGAGTCTTCTTCTCCTCCTCCTCCTCCGCCTCCGCCTCAACCGCTGGCAT
CGCAACAGAAGAGGAAGAAGAACGTTGAGACGACGGATTGGGTCGCTTCTTCCTTGACCCGGCGGTTTGGAATCGGCGCG
GGTCTTGCCTGGGCGGGCTTTCTGGCTTTCGGTGTAATCTCCGAGCAGATCAAGACTCGGATTGAGGTTTCTCAGGAAGT
AGCTAACACCAGAGATGTAGAAGAAGAGAAAGAGATTGTGTTGCCCAACGGCATAAGGTACTATGATCAACGGGTTGGAG
GAGGAGCAACACCAAGAGCAGGAGACTTGGTAGTGATTGATCTAAAGGGGCAAGTGCAAGGAACCGGACAAGTATTCGTG
GATACATTTGGAACCAAAGACAAGAAGAAGATGAAGCCATTGGCACTTGTGGTGGGTTCAAAACCATATAGCAAAGGATT
ATGTGAAGGCATAGATTATGTACTAAGGTCCATGAAGGCTGGAGGTAAACGCAGAGTGATTGTTCCACCATCGTTAGGAT
TTGGTGTAGACGGTGCTGAATTGGAATCGGGTTTGCAGATTCCTCCTAATGCTTCGTTGGAATATATAGTTGAGATTGAT
AGAGTCTCAATTGCACCAGCTTGA