Details for Arabidopsis Locus AT1G18160

Position : Chr1 ( 5`- 6248793 .. 6254039 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18160

Protein [Map View]
MKMNMKKFLKKLRITPNQRDDGEGSVSNRSNKSSDAEPSPSDSLRSQDNSEFKPFLGLSNWLSSVTHRKSPSSSNATNSK
EDDTTMEHGGPVGSESGMQGLGSSSNSKDPEVEEEYQIQLALELSAREDPEAAQIEAMKQFSLGSRPSAPENTPAELMAY
RYWNYNCLGYDDKIVDGFYDLCGVMNESSLKRIPPLVDLQGTLVSDGVTWDAVLVNSSKDSNLLRLEQMALDIAAKSKSA
SSSGFVNSELVRQLAVLVADYMGGPVLDPDSTLRAWWSLSYSLKATLRSMVLPLGSLTIGLARHRALLFKVLCDSVGVPC
RIVKGQQYTGSDDVAMNSIKTDDGREYIVDLMGDPGTLIPADAAGLQMDFDDSVYSASPRDVDSSHVASSSSGVESSIEE
HTESWSAEHRSRTKGSREENQSAGGGDLMIPNIREAVGSQKAPVQHLSSKPTHSFTHARSPSWTEGVSSPAGRRMKVKDV
SQYMIDAAKENPQLAQKLHDVLLESGVVAPRNLFSEVYSESMEATGEIKSVAESNDEKGKDFGTIQQGRNQSNLGPVRFL
PPLPRPQSKAITHDLREHSGSGLGHLSEHCNIDGHSDSSHSETSTDYPRNVPVAVAAAAVVASSMVVAAAKSANSDSSTL
ELSAAAAAAVMATAAAVSRQFELDSLSNGDAGSGGLHGVDSGGERISDRSIGNESSKSDAAIDDVAECEILWEEITVAER
IGLGSYGEVYRGDWHGTAVAVKKFIDQDITGEALEEFRSEVRMMRRLRHPNIVLFMGAVTRPPNLSIVTEFLPRGSLYRL
IHRPNNQLDERKRLRMALDAARGMNYLHSCNPVIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKVSTYLSSKSTAGTAEWM
APEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLDIPEFVDPGIADIIRKCWQTDPRLRPSF
GEIMDSLKQLQKPIQRAAVPSSSALTTDEQEQ*

DNA
ATGAAGATGAACATGAAGAAATTTCTCAAAAAGCTTCGTATCACGCCCAATCAACGAGACGATGGTGAAGGTTCAGTCTC
TAACAGAAGCAATAAGTCTAGTGATGCAGAACCATCTCCTTCTGATTCATTGAGGTCTCAAGATAACTCTGAATTCAAAC
CCTTTTTGGGTTTATCAAATTGGTTAAGCTCTGTTACTCACAGGAAAAGCCCTTCTTCTTCCAATGCCACCAATAGCAAA
GAGGATGACACTACCATGGAACATGGTGGTCCCGTTGGGTCGGAATCTGGGATGCAGGGTTTGGGTTCTAGTAGTAATTC
CAAGGATCCAGAAGTTGAAGAAGAATATCAGATACAGTTGGCTCTAGAGTTAAGTGCTAGGGAGGATCCTGAAGCTGCTC
AGATTGAGGCTATGAAGCAGTTCAGCTTAGGTTCTCGTCCTTCTGCTCCCGAGAATACTCCAGCTGAACTCATGGCATAT
AGATATTGGAATTATAACTGTCTTGGCTATGATGACAAGATTGTGGATGGTTTCTATGACCTGTGTGGAGTAATGAATGA
ATCTTCCTTAAAAAGAATACCTCCCTTAGTTGATCTTCAGGGGACACTTGTGTCAGATGGTGTAACTTGGGATGCTGTTC
TAGTGAACAGCAGCAAAGATTCTAATCTGTTGAGACTTGAACAAATGGCTCTTGATATTGCAGCAAAATCAAAGTCAGCG
TCTTCTTCAGGGTTTGTGAACAGTGAATTGGTAAGGCAACTGGCAGTTTTAGTTGCTGATTACATGGGTGGACCAGTTTT
GGATCCAGATAGCACGTTAAGAGCTTGGTGGAGTCTGAGCTACAGCTTGAAAGCAACCCTCCGTAGCATGGTTCTGCCCC
TGGGTTCTCTAACTATTGGATTGGCTCGTCATCGTGCCTTGTTATTCAAAGTTTTGTGTGATAGTGTCGGCGTTCCTTGT
CGAATAGTCAAAGGACAGCAATATACCGGTTCAGATGATGTGGCAATGAACTCCATTAAGACTGATGATGGCAGGGAGTA
CATTGTTGATCTCATGGGAGATCCAGGCACGCTTATCCCCGCTGATGCAGCTGGACTACAAATGGACTTTGATGATTCTG
TCTACTCTGCCAGTCCCAGAGATGTTGATTCATCTCATGTAGCTTCTTCCAGCAGTGGGGTCGAGAGCTCAATTGAAGAA
CACACAGAATCTTGGTCAGCGGAACATCGTTCTAGGACCAAGGGTTCCCGGGAGGAAAACCAATCTGCAGGTGGAGGGGA
TCTCATGATTCCAAATATTAGGGAAGCTGTGGGAAGTCAAAAGGCTCCTGTTCAACATCTTTCCAGCAAGCCTACTCATT
CTTTCACTCATGCCAGATCACCTTCGTGGACTGAAGGTGTTAGCTCTCCAGCTGGACGCAGGATGAAAGTCAAAGATGTT
TCACAATATATGATTGATGCTGCCAAAGAGAATCCACAACTAGCTCAGAAGCTTCATGATGTGTTACTTGAAAGTGGAGT
TGTAGCTCCTCGAAATTTATTTTCGGAAGTCTATTCAGAGTCAATGGAGGCAACAGGTGAAATCAAATCTGTGGCTGAAT
CCAATGATGAGAAAGGGAAAGATTTTGGAACAATCCAGCAAGGAAGAAACCAGAGCAACCTTGGCCCTGTGAGGTTTTTG
CCTCCTCTTCCAAGACCGCAATCTAAAGCAATTACCCATGACCTACGTGAACATTCAGGATCTGGACTCGGTCATTTGTC
TGAACATTGCAATATTGATGGTCACTCTGATTCCTCACATTCTGAAACATCTACTGACTATCCCAGAAATGTTCCTGTTG
CCGTAGCTGCAGCGGCTGTTGTTGCGTCTTCCATGGTTGTTGCTGCCGCCAAGTCAGCAAACTCGGATTCCTCCACTTTA
GAACTTTCTGCTGCAGCTGCTGCTGCAGTTATGGCGACAGCTGCAGCAGTGAGCAGGCAGTTTGAACTAGATTCACTTAG
CAACGGGGATGCTGGTTCTGGTGGGCTTCATGGGGTAGATTCAGGAGGAGAACGAATATCCGACAGATCTATTGGCAATG
AAAGTTCAAAATCTGATGCTGCAATTGATGATGTAGCTGAATGCGAGATTTTGTGGGAGGAAATTACTGTGGCTGAGCGT
ATCGGACTGGGATCATACGGAGAGGTATATAGGGGAGATTGGCATGGAACTGCAGTGGCTGTCAAGAAGTTCATTGACCA
AGATATTACTGGAGAGGCACTGGAGGAATTCAGAAGTGAGGTCCGGATGATGAGAAGGCTCAGACACCCTAATATTGTTC
TCTTCATGGGAGCTGTAACCCGCCCACCAAATCTCTCAATTGTTACAGAATTTCTTCCTCGAGGTAGCTTGTATAGGTTA
ATTCACAGGCCTAATAACCAATTAGATGAGCGAAAGCGTCTGAGGATGGCTCTTGATGCTGCTCGTGGAATGAATTATTT
ACACAGCTGTAATCCGGTAATTGTCCATCGTGATCTTAAATCTCCAAACCTTCTAGTTGACAAAAATTGGGTTGTCAAGG
TGTGCGATTTTGGGTTGTCTAGAATGAAAGTAAGCACATACCTCTCTTCAAAGTCAACAGCAGGCACGGCTGAATGGATG
GCTCCAGAAGTGCTTAGAAACGAACCCGCAGATGAGAAGTGTGATGTGTACAGCTACGGGGTCATTCTCTGGGAACTCTT
TACGTTACAGCAACCATGGGGAAAAATGAACCCAATGCAAGTGGTTGGCGCGGTTGGTTTTCAACATCGACGACTTGATA
TCCCTGAATTTGTGGATCCTGGAATTGCAGATATCATCAGGAAATGTTGGCAGACGGATCCAAGGTTAAGACCAAGTTTT
GGAGAGATCATGGATTCTTTAAAGCAGCTACAGAAACCTATCCAGAGAGCAGCAGTTCCCAGTTCTTCTGCATTGACCAC
TGATGAGCAGGAACAATAA