Details for Arabidopsis Locus AT1G18150

Position : Chr1 ( 5`- 6244298 .. 6247812 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18150

Protein [Map View]
MGGGGNLVDGVRRWLFQRPSSSSSSSSSNNNNNNHEQPIFNSSSFSSSSNPNHSANSGELIIEEDLDFSGLTLINVPKRN
HLPMDPHKKGETEFFTEYGEANRYQIQEVVGKGSYGVVASAVDSHTGERVAIKKINDVFEHVSDATRILREIKLLRLLRH
PDVVEIKHIMLPPSRREFRDIYVVFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYVHAANVFHRDLKPKNILANA
DCKLKICDFGLARVSFNDAPTAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIFAEMLLGKPLFPGKNVVHQLD
LMTDFLGTPPPESISRIRNEKARRYLSSMRKKQPVPFSHKFPKADPLALRLLERLLAFDPKDRASAEDALADPYFSGLSN
SEREPTTQPISKLEFDFERKKLVKDDVRELIYREILEYHPQMLEEYLRGGDQLSFMYPSGVDRFKRQFAHLEENQGKPGA
AGGGRSTALHRHHASLPRERVPAPNGETAEESSDVERRAAAAVASTLESEEADNGGGYSARNLMKSASISGSKCIGVQSK
TDKEDTIAEEEDNETVAELTDKVASLHNS*

DNA
ATGGGTGGTGGTGGGAATCTCGTCGACGGTGTTCGTCGATGGCTTTTTCAGCGACCTTCTTCTTCTTCTTCTTCTTCTTC
TTCCAACAATAATAATAATAATCACGAACAACCCATTTTCAATTCTTCTTCTTTCTCTTCTTCCTCTAACCCCAATCATT
CCGCTAACTCTGGAGAGCTTATTATTGAAGAAGATCTCGATTTCTCTGGTCTAACGCTTATTAACGTTCCTAAACGTAAT
CATTTACCTATGGATCCTCACAAGAAGGGTGAAACTGAATTCTTCACGGAGTATGGAGAAGCTAACAGGTATCAGATTCA
AGAGGTTGTTGGCAAAGGAAGTTATGGTGTTGTGGCTTCTGCTGTTGACTCACACACTGGAGAGAGAGTTGCGATCAAGA
AGATCAACGATGTGTTTGAGCATGTCTCCGATGCTACTAGGATTCTCAGAGAGATCAAATTGCTTCGGTTGCTTCGTCAT
CCTGATGTTGTGGAGATTAAACACATCATGTTACCTCCTTCTCGCAGAGAATTCCGCGATATTTATGTTGTCTTTGAGTT
GATGGAATCTGATCTTCATCAAGTGATCAAGGCGAATGATGATTTGACTCCTGAGCATTATCAGTTTTTCTTGTACCAGC
TTCTTCGTGGTCTGAAATATGTTCACGCAGCTAATGTGTTTCATCGGGATTTGAAACCGAAGAACATTCTAGCTAATGCT
GATTGCAAATTGAAGATCTGTGATTTTGGGCTGGCTCGCGTTTCTTTTAACGATGCCCCAACCGCTATATTTTGGACTGA
TTATGTAGCTACTCGGTGGTATCGTGCCCCTGAACTCTGTGGATCGTTTTTCTCCAAATATACCCCTGCGATTGATATCT
GGAGTGTCGGTTGCATTTTTGCGGAAATGCTTTTGGGTAAGCCTTTGTTTCCCGGGAAAAACGTTGTGCACCAATTGGAT
CTAATGACTGACTTTCTTGGTACTCCACCTCCTGAGTCAATATCAAGGATTAGAAATGAAAAGGCGAGGAGATATCTTAG
CAGCATGAGGAAAAAACAACCAGTCCCTTTCTCTCATAAATTCCCTAAAGCTGATCCTTTGGCTCTCCGCCTTCTGGAAC
GCCTGCTTGCCTTTGATCCGAAAGATCGTGCATCAGCTGAAGATGCACTAGCTGATCCATATTTCAGTGGTTTGTCAAAT
TCAGAGCGTGAACCAACAACACAGCCAATTTCAAAGCTTGAATTTGACTTTGAGAGAAAGAAGTTAGTTAAAGATGATGT
CAGAGAATTAATTTACCGAGAGATATTGGAATATCATCCTCAGATGTTGGAGGAATACCTTCGTGGTGGTGATCAGCTTA
GCTTTATGTACCCAAGTGGGGTAGACCGATTTAAAAGGCAATTTGCTCATCTTGAAGAAAATCAAGGTAAACCAGGAGCA
GCAGGAGGAGGAAGAAGTACTGCACTTCACAGACATCATGCTTCCTTGCCAAGAGAGAGAGTTCCTGCTCCAAATGGTGA
AACTGCAGAAGAAAGCAGTGATGTTGAGAGAAGAGCAGCAGCTGCTGTGGCTTCAACCTTGGAATCCGAGGAAGCAGACA
ATGGAGGAGGTTACAGTGCTCGTAACCTCATGAAGAGTGCAAGCATCAGCGGTTCTAAATGCATTGGTGTCCAATCTAAA
ACTGACAAAGAGGATACCATAGCTGAGGAAGAAGATAATGAAACAGTTGCAGAGCTTACTGATAAAGTTGCTTCTCTTCA
CAATTCTTAA