Details for Arabidopsis Locus AT1G18130

Position : Chr1 ( 5`- 6235895 .. 6238799 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G18130

Protein [Map View]
MSKNHPDEDETNLSSAVDFHLRDRFKLEYSAENETMIERSVLIHRAVLSSVERLFAILLEQYKGKFPFWLSPRQAIVCSV
SEDYRSYADKVRDQIHEAGYYVDVDTTDRNVSDKVQEAQVAHYNYILVVGDEEARTGQVTVWLRDEMMSIETLSDEFKLK
TANFL*

DNA
ATGTCGAAGAATCATCCCGATGAGGATGAAACAAACCTATCCTCTGCCGTTGATTTTCACCTTCGTGATCGCTTCAAACT
AGAATATTCAGCTGAGAATGAAACTATGATAGAGAGATCTGTGCTGATACATAGAGCGGTGTTGAGCTCTGTTGAGCGTC
TTTTTGCCATATTGTTGGAACAGTACAAAGGAAAATTCCCCTTCTGGCTTAGTCCCCGCCAGGCCATAGTTTGCTCTGTT
TCAGAGGATTATCGTTCCTACGCAGACAAGGTGAGAGATCAAATTCACGAAGCTGGCTACTATGTTGATGTTGACACAAC
GGATAGAAACGTCAGTGACAAGGTGCAAGAAGCTCAGGTTGCACACTACAACTACATACTAGTCGTGGGTGATGAAGAGG
CTAGAACGGGACAGGTGACTGTTTGGCTTAGAGACGAAATGATGAGCATCGAGACTCTGTCGGATGAATTCAAATTGAAG
ACGGCCAACTTTCTTTGA