Details for Arabidopsis Locus AT1G14210

Position : Chr1 ( 5`- 4856778 .. 4857964 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G14210

Protein [Map View]
MRGIIIVSLLILQSLVVSSSQTEPDFNFFYWVNYWPGAICDSQKGCCPPTKGNTASDFIIHGLWPQFNNGTWPAFCDQTN
LFDISKISDLVCQMEKKWTEWGVWACPSNETNLWEHEWNKHGTCVQSIFDQHSYFRTNLKFKHKVHLLNILIQKGIKPND
GFYSLDEIKNAIKCAIGFAPGIECNEDVKGNKQLFQIYICLDNYAKEFVECPYVPDKSCASKIKFPSLPERDSLNESLSV
MSSVSTT*

DNA
ATGAGAGGAATCATCATCGTAAGCTTGTTAATTTTACAGAGCCTTGTCGTGTCTTCGTCTCAAACAGAACCAGACTTCAA
TTTCTTCTACTGGGTCAACTACTGGCCAGGAGCAATATGCGATAGCCAAAAAGGATGTTGCCCTCCAACGAAAGGCAACA
CAGCGTCGGATTTTATCATCCATGGACTCTGGCCTCAGTTCAACAATGGCACTTGGCCTGCGTTTTGCGACCAAACCAAT
CTCTTCGATATCTCCAAGATATCAGATCTAGTCTGCCAAATGGAAAAGAAATGGACAGAGTGGGGAGTGTGGGCATGTCC
AAGTAACGAGACAAATCTATGGGAACACGAGTGGAATAAGCATGGCACCTGTGTCCAATCTATCTTCGACCAACACTCTT
ACTTCCGTACCAATCTCAAATTCAAACACAAAGTCCATCTCCTCAACATCCTTATACAAAAAGGTATTAAACCAAATGAT
GGGTTTTACAGTTTGGACGAGATCAAAAATGCGATCAAATGCGCGATCGGATTTGCACCGGGTATCGAATGCAATGAAGA
TGTAAAGGGGAATAAGCAGCTTTTCCAGATCTATATATGTCTTGATAATTACGCAAAAGAGTTTGTGGAATGCCCGTATG
TTCCGGATAAATCATGTGCTTCCAAGATCAAGTTTCCAAGTCTTCCTGAGAGAGATTCTCTTAATGAGTCTCTAAGTGTG
ATGTCCTCTGTTTCAACTACCTAA