Details for Arabidopsis Locus AT1G14200

Position : Chr1 ( 5`- 4854384 .. 4855200 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G14200

Protein [Map View]
MSSENDFVEFSSMFERIIQGRGDGLSRFLPVIVALAAREDDDDQGSTDQTTRRGDPLSPRFVMIGSRSGLDDFFSDGGKQ
GRSPALKSEVENMPRVVIGEDKEKYGGSCAICLDEWSKGDVAAEMPCKHKFHSKCVEEWLGRHATCPMCRYEMPVEEVEE
EKKIGIWIGFSINAGDRRN*

DNA
ATGTCTTCTGAGAATGATTTCGTTGAGTTTTCTTCTATGTTCGAGAGAATTATACAAGGAAGAGGTGATGGTCTCTCTCG
ATTTTTGCCGGTGATTGTAGCTTTAGCCGCCAGAGAAGACGATGATGACCAAGGATCTACCGATCAAACAACGAGACGGG
GAGATCCGTTGAGTCCAAGGTTCGTGATGATCGGATCGCGATCGGGACTCGACGATTTCTTTAGCGACGGTGGAAAACAA
GGGAGGTCGCCGGCGTTGAAGTCAGAAGTGGAGAATATGCCACGTGTCGTGATCGGAGAAGATAAGGAGAAATATGGTGG
TTCTTGCGCGATTTGTTTGGATGAGTGGTCTAAAGGTGACGTGGCGGCGGAGATGCCTTGTAAACATAAGTTTCACTCAA
AGTGTGTGGAGGAGTGGTTAGGGAGGCACGCCACGTGTCCTATGTGTAGGTATGAGATGCCTGTTGAAGAAGTTGAAGAA
GAGAAGAAGATTGGGATTTGGATTGGTTTCTCCATTAACGCCGGCGACAGAAGAAACTAA