Details for Arabidopsis Locus AT1G14040

Position : Chr1 ( 5`- 4810488 .. 4814543 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G14040

Protein [Map View]
MKFGKEFSSQMVPEWQQAYMDYDFLKTLLKEIITFKRRTNNAPSHGGAKTGGGLNRKLTLYRAFSGLVSTPRHKRSNSSH
DVEEGVQLTGSMRSGPILVNTTASHGYETTFLMAAEEGGEYELVFFRRLDDEFNKVDKFYRKKVEEVLKEAAMLNKQMDA
LIAFRVKVENPDGWRWEERTVEMTRLASDIATSAAALSASTPAGAKSMKVRSQEHMEAIQEGGSSRAGLMEDDEEDEDEQ
NETSVVSTGAIDNETTTSRMRGARPSPIDVLGRVKINNTKETPRSTIKGVLKVSKQTDLKFSRENLMKVEESLKRAFIEF
YQKLRLLKSYSFLNVLAFSKILKKYDKITSRDATKPYMKVVDSSYLGSSDEVMRLMERVEATFIKHFANANRAKAMNILR
PKAKRERHRITFSTGFSAGCVFSLIVALVAIIRTRNLLEMEGQKEYMNTMFPLYSLFGFIVLHIIVYAANIYYWRRYRVN
YSFIFGFKQGTELGYRQVLLVGFSIGVLALLCVLANLDMEADPKTKAYQARTEILPLILLAAMFIVLVLPFNYFYRSSRF
FFLTCLFHCLAAPLYKVTLPDFFLGDQLTSQVQAIRSIEFYICYYGWGDFRHRKSTCKESDVYNTFFFIVAVIPYVSRLL
QCLRRLFEEKNPEQGYNGLKYFLTIVAVCLRTAYSIQKGQVAWRVLAAVFSFIAAIFCTYWDFVHDWGLLNRTSKNRWLR
DKLLVPQKKVYFIAMVLNVLLRFAWIQTVLDFNFSFMHRQTMVAIVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKSVP
LPFNYDEDDDKDN*

DNA
ATGAAGTTCGGAAAAGAGTTCTCGTCTCAGATGGTGCCAGAGTGGCAACAAGCTTACATGGATTACGATTTTCTCAAAAC
TCTTCTCAAAGAAATCATCACATTCAAACGAAGAACCAACAATGCACCTTCTCATGGTGGTGCCAAGACCGGCGGAGGAT
TAAACCGGAAATTGACTCTATACCGTGCGTTTAGCGGTCTTGTCTCAACGCCAAGGCATAAACGTAGTAATAGCTCTCAT
GATGTTGAAGAAGGTGTACAGTTGACGGGATCGATGAGGTCGGGGCCGATTCTTGTGAACACGACCGCGAGTCATGGTTA
TGAGACGACGTTTCTGATGGCCGCGGAAGAAGGAGGAGAGTACGAACTAGTGTTTTTCCGGCGACTAGACGATGAGTTCA
ATAAGGTTGATAAGTTTTACAGAAAGAAAGTTGAAGAAGTGTTGAAAGAAGCGGCGATGCTTAATAAACAGATGGACGCT
TTGATCGCGTTTCGTGTTAAAGTTGAGAACCCAGATGGATGGAGATGGGAGGAACGGACGGTGGAGATGACTCGATTAGC
TTCCGATATTGCTACTTCTGCGGCGGCTCTCTCTGCTTCTACTCCAGCCGGAGCTAAATCCATGAAAGTTAGAAGTCAAG
AGCACATGGAAGCAATCCAAGAAGGAGGCTCGAGCAGAGCTGGGCTAATGGAAGATGATGAAGAAGACGAAGACGAACAA
AACGAAACCTCTGTGGTATCTACCGGAGCAATCGATAATGAGACTACTACGAGCAGGATGAGAGGAGCGAGACCATCTCC
GATCGATGTACTTGGTCGAGTTAAGATCAACAACACAAAAGAGACACCTCGTTCCACCATTAAAGGAGTTCTCAAAGTAT
CAAAACAGACAGATTTAAAATTCAGCAGAGAGAATCTGATGAAAGTCGAAGAGAGTCTCAAGCGTGCTTTCATCGAGTTT
TATCAGAAGCTTCGACTTCTCAAGAGCTATAGTTTTTTGAATGTATTGGCGTTCTCGAAGATATTGAAGAAGTATGATAA
GATAACTTCGAGAGATGCAACGAAGCCTTACATGAAAGTGGTTGATAGTTCATACTTGGGAAGCTCTGATGAGGTAATGA
GACTCATGGAGCGTGTTGAAGCAACATTCATTAAGCATTTTGCTAACGCTAATCGGGCAAAAGCAATGAACATTTTACGA
CCTAAAGCGAAACGAGAGAGACATAGAATTACATTTTCCACAGGTTTCTCGGCTGGTTGCGTTTTTTCTCTTATAGTGGC
TCTTGTTGCTATCATCCGTACCCGAAATCTCTTGGAAATGGAAGGCCAGAAGGAATACATGAATACTATGTTCCCTCTTT
ATAGCTTGTTCGGGTTTATCGTGCTGCATATCATCGTGTATGCTGCTAATATATACTACTGGAGGCGATATCGAGTAAAC
TATTCCTTCATATTTGGGTTCAAGCAAGGAACTGAACTTGGATACAGACAAGTCCTGCTTGTTGGTTTCAGCATCGGAGT
CTTGGCATTGCTTTGTGTTCTTGCCAATCTTGACATGGAGGCAGACCCCAAAACGAAAGCCTATCAAGCTAGAACTGAAA
TTCTTCCTCTTATCCTACTTGCTGCTATGTTCATTGTTCTAGTCCTGCCATTCAACTACTTTTACCGCTCGAGTCGCTTT
TTCTTCCTCACTTGTCTGTTTCACTGCCTCGCAGCTCCACTTTACAAGGTTACATTGCCTGATTTCTTCTTGGGAGATCA
GTTAACTAGCCAGGTTCAAGCGATTCGAAGCATCGAGTTCTATATATGTTACTATGGTTGGGGAGACTTCAGACACAGAA
AAAGCACTTGCAAAGAATCTGATGTCTACAACACTTTCTTCTTCATTGTTGCTGTCATCCCTTATGTCTCTCGCCTCCTT
CAGTGCCTGCGACGGCTGTTTGAGGAAAAAAACCCGGAACAAGGGTACAACGGACTCAAGTATTTCTTGACTATAGTGGC
GGTTTGCTTGAGAACGGCTTACAGTATCCAAAAAGGTCAAGTCGCTTGGAGGGTTTTAGCTGCTGTCTTCTCATTTATAG
CTGCAATATTCTGTACTTACTGGGACTTTGTCCATGATTGGGGTCTTCTAAACCGGACATCCAAAAACCGTTGGCTTCGA
GATAAACTCCTTGTTCCTCAAAAGAAAGTATACTTCATAGCGATGGTTTTGAATGTCCTGTTGAGATTTGCGTGGATCCA
GACAGTTTTAGATTTCAACTTTTCTTTCATGCATAGACAGACGATGGTTGCCATTGTCGCTAGTCTTGAGATCATTCGTC
GTGGTATATGGAATTTCTTCAGATTGGAGAACGAGCATTTGAACAATGTCGGGAAATACCGAGCCTTCAAGTCCGTCCCA
TTACCGTTCAACTACGATGAAGATGACGATAAAGATAACTAG