Details for Arabidopsis Locus AT1G14010

Position : Chr1 ( 5`- 4800169 .. 4801850 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G14010

Protein [Map View]
MNHRRSSIVLLILSILSPVTLSIRYELLSGHTKCISEEIHANAMTIGKYSIINPHEDHPLPSSHKVTVRVTSPQGTAYHE
SDGVESGQFSFVAVETGDYISCFSAVDHKPETTLIIDFDWRTGIHTKDWSNVAKKSQVETMEFEVKKLFETVNGIHDEMF
YLRDREEEMHNLNIATNSKMAWLSFVSLAVCLSVAGLQFWHLKTFFQKKKLI*

DNA
ATGAATCATCGTCGGAGCTCGATCGTACTATTGATCCTCTCAATTTTATCTCCCGTGACACTCTCTATACGATACGAGCT
ACTTTCTGGGCACACGAAATGCATCTCAGAGGAGATTCACGCAAACGCAATGACCATCGGAAAATACAGCATTATAAACC
CTCACGAGGATCATCCTCTTCCTTCTTCCCATAAAGTCACCGTCAGGGTCACATCGCCACAAGGGACGGCTTATCACGAA
TCGGACGGAGTAGAATCGGGACAATTCTCGTTTGTAGCTGTGGAAACAGGGGATTACATAAGTTGCTTCTCCGCCGTCGA
TCACAAACCAGAGACGACGCTGATCATTGACTTTGATTGGAGGACGGGTATTCATACCAAGGATTGGTCGAATGTGGCAA
AGAAGAGCCAAGTCGAAACGATGGAGTTTGAGGTTAAGAAGTTATTTGAAACCGTGAATGGAATCCACGATGAGATGTTC
TATCTCCGCGACAGGGAAGAAGAAATGCACAATCTGAACATAGCGACAAATTCGAAGATGGCATGGTTGAGTTTCGTGTC
GCTTGCAGTTTGTTTATCGGTCGCAGGTCTTCAGTTTTGGCACTTGAAGACTTTCTTCCAGAAAAAGAAGCTTATCTGA