Details for Arabidopsis Locus AT1G13950

Position : Chr1 ( 5`- 4773576 .. 4774867 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G13950

Protein [Map View]
MSDEEHHFESSDAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTSKKLEDIVPSSHNC
DVPHVNRTDYQLIDISEDGYVSLLTDNGSTKDDLKLPNDDTLLQQIKSGFDDGKDLVVSVMSAMGEEQINALKDIGPK*

DNA
ATGTCCGACGAGGAGCATCACTTTGAGTCCAGTGACGCCGGAGCGTCCAAAACCTACCCTCAACAAGCTGGAACCATCCG
TAAGAATGGTTACATCGTCATCAAAAATCGTCCCTGCAAGGTTGTTGAGGTTTCAACCTCGAAGACTGGCAAGCATGGTC
ATGCTAAATGTCATTTTGTAGCTATTGATATCTTCACCAGCAAGAAACTCGAAGATATTGTTCCTTCTTCCCACAATTGT
GATGTTCCTCATGTCAACCGTACTGATTATCAGCTGATTGACATTTCTGAAGATGGATATGTCAGTTTGTTGACTGATAA
CGGTAGTACCAAGGATGACCTTAAGCTCCCTAATGATGACACTCTGCTCCAACAGATCAAGAGTGGGTTTGATGATGGAA
AAGATCTAGTGGTGAGTGTGATGTCAGCTATGGGAGAGGAACAGATCAATGCTCTTAAGGACATCGGTCCCAAGTGA