Details for Arabidopsis Locus AT1G13940

Position : Chr1 ( 5`- 4762703 .. 4766749 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G13940

Protein [Map View]
MGTKVHCESLFGGYHHSMGDLNKESNNGCRWPLFYGDNKTSASNNDQCYNNGFTSQTTFGFDKDVVRRTMLEHEAVFKTQ
VLELHRVYRTQKDMMDELKRKQFNKEWVQIEASLSSQATNDDVRKWKIPSFPLANSVYDRPSMSVVEDNGHSPMKGSNSQ
GPVSWQNGASSKSVEVSEVRPTKIRRKMIDLCLPADEYIDDNEEVVELKDHRVCSTSSQLPNGDVKTESRIDGVRIGYGS
SRSNGLADLNEPVDAQEANEFAYGHSRDLRNGEFQGHIRDYGKSLNSGSVREHIPVIPLQPDLNGKPKVWSHQPLRTDHY
NGTHKSAAPFFQPAKPLDSLSQPMQVLMNSSQRVMSLPNSGPPSKAVVWRERTFIDLEADTDTNSSHEAVIHQNHLDSSL
TSHQQRPLYPYIRPDSAVSWNHLHSSWQNPSFGFPQKVASAQRYPVLNMSDTLIGNAQKQGYLGDRLQFESNSRFDSGCG
NSSRLNHNMFYNECSTSSKSKVAGTGYNYPNGGRSDYSSERKFVRDLNLNVTLSNTSVVEVRKDEEHLATLPWLNKPKSV
CNSELADGKWSLKSNDAVPSSSLKPLDIRDEAGDKVQNIMWLERLKSGSCSNNPVTEKIDANKEIPGLAYKDQSNVEKGK
VHYVRMLDMNEPCDPLWDEDQQTEEQTETRVSASNRCQIDLNILGSDDEGENCSVPASSRLNSKAPMIDLETVPESDDEE
EDGNISGEKRSEVKSIEEKTLEKPPEFEKLAAETIVAIYSACLDREVEVVASSEVSETIILHWFAETVNTHKENLDKKLD
TFSRNQSRSIEDIDYFESMTLQLPDISEQEYMPKPLVPENLKLEETTGTALVTSQRPRRGNARKGKQRRDFQRDILPGLL
SLSKHEVTEDIQMFDGFMRATGRSWTPTGLTRKKTGSRGRPRRAITIPAEPVYCPVPAPAPPPPSVQQHVSNQSNNGETE
MCLEDRSFAGWGKMTRRPRRQRCPSASTTTATTSNQRSSSHAPFT*

DNA
ATGGGAACAAAGGTGCACTGTGAAAGCTTATTTGGTGGATATCATCATTCTATGGGAGATCTCAACAAAGAATCTAATAA
CGGTTGTAGATGGCCATTGTTCTACGGTGACAATAAAACCTCTGCATCAAACAACGATCAATGCTACAATAATGGGTTCA
CGTCTCAGACTACATTTGGGTTTGACAAAGATGTGGTGAGAAGGACAATGCTCGAACACGAAGCTGTTTTTAAGACACAG
GTTTTGGAACTTCACCGGGTATATAGGACACAGAAGGATATGATGGATGAATTGAAAAGGAAACAGTTTAATAAAGAATG
GGTTCAGATTGAGGCATCACTTTCTTCTCAAGCTACGAATGATGATGTTCGTAAATGGAAAATCCCTAGCTTCCCTTTGG
CGAACTCGGTTTACGATAGACCATCCATGTCGGTTGTTGAGGATAATGGCCATTCTCCCATGAAAGGAAGCAATTCTCAA
GGTCCAGTTTCATGGCAAAATGGAGCTAGTTCCAAAAGTGTTGAAGTGTCCGAGGTTAGACCGACGAAAATCAGAAGAAA
GATGATAGATCTTTGCCTTCCAGCTGATGAGTACATTGATGACAATGAAGAAGTTGTTGAGTTAAAGGATCACAGGGTCT
GCAGTACATCGAGTCAGCTTCCTAATGGAGATGTGAAGACTGAATCTCGCATAGATGGTGTGAGAATTGGCTATGGGTCT
AGTAGAAGCAATGGTTTGGCTGACTTAAATGAACCAGTTGATGCTCAAGAAGCAAACGAATTTGCTTATGGCCACTCCCG
TGACTTGCGTAATGGGGAGTTTCAAGGCCATATTCGTGACTACGGAAAATCTCTAAACTCAGGTAGTGTAAGGGAGCATA
TTCCTGTTATCCCTCTGCAGCCAGATTTGAACGGCAAACCAAAAGTTTGGTCACACCAACCCCTAAGAACTGATCATTAT
AATGGCACACACAAGTCTGCTGCTCCATTTTTTCAACCGGCTAAACCACTGGATTCTTTGTCTCAGCCTATGCAAGTTTT
GATGAACAGTTCACAAAGAGTTATGAGTTTACCTAATTCAGGTCCACCAAGTAAGGCAGTCGTCTGGAGAGAAAGAACGT
TTATTGACCTAGAGGCTGATACTGATACCAATAGTAGTCATGAAGCCGTCATTCATCAAAATCACTTGGATTCAAGTTTA
ACTTCTCACCAACAGCGCCCCTTGTATCCATATATTCGTCCAGATTCTGCTGTCTCCTGGAACCATTTGCACTCTTCTTG
GCAAAATCCTAGCTTTGGATTCCCTCAGAAAGTTGCTTCAGCTCAGAGATATCCGGTTCTAAACATGTCTGATACACTGA
TTGGTAATGCTCAGAAGCAAGGGTATCTTGGAGATAGATTGCAGTTTGAAAGCAATTCTAGATTTGACTCAGGGTGCGGG
AATTCCAGTCGGTTAAACCACAATATGTTTTACAATGAGTGTTCCACTTCATCAAAATCGAAAGTCGCTGGGACTGGCTA
TAATTATCCTAACGGAGGAAGAAGTGATTACAGCTCGGAGAGGAAGTTTGTGAGGGATTTGAACTTAAATGTGACACTTT
CAAACACTTCTGTTGTTGAAGTCAGAAAGGATGAAGAACACCTGGCTACTTTACCATGGCTTAATAAACCCAAGTCTGTT
TGTAACTCTGAGTTAGCTGATGGGAAATGGAGTCTGAAGAGTAATGATGCTGTTCCAAGTTCTTCTTTGAAACCATTGGA
TATCAGAGATGAGGCAGGAGACAAAGTTCAGAATATTATGTGGCTAGAGAGGTTAAAGTCTGGTTCTTGTTCCAATAATC
CGGTGACTGAGAAGATCGATGCTAACAAGGAAATTCCTGGATTGGCTTATAAAGATCAATCCAATGTAGAGAAAGGTAAA
GTCCATTACGTTAGGATGCTAGACATGAACGAACCGTGTGATCCTCTTTGGGATGAAGATCAGCAAACAGAGGAACAGAC
TGAGACAAGGGTTTCAGCTAGTAATAGGTGTCAGATTGATTTGAACATTTTGGGCAGTGATGATGAAGGCGAAAATTGCT
CTGTTCCTGCCAGTTCAAGACTGAATTCAAAGGCTCCTATGATAGATTTGGAAACTGTTCCTGAGTCTGATGATGAAGAA
GAAGATGGTAATATCTCTGGAGAAAAGCGATCAGAAGTAAAATCAATTGAGGAAAAAACTCTAGAGAAACCGCCTGAGTT
TGAAAAATTAGCAGCAGAAACAATAGTTGCCATCTATTCAGCTTGCCTAGATAGAGAGGTTGAAGTTGTTGCTTCGTCAG
AAGTTTCTGAAACCATCATCCTTCACTGGTTTGCAGAAACAGTAAATACTCACAAAGAGAATCTGGACAAAAAGCTCGAT
ACTTTTTCAAGGAATCAATCGCGTTCTATCGAAGATATTGATTACTTTGAGTCAATGACCCTGCAACTACCTGATATCTC
AGAACAAGAGTATATGCCTAAGCCATTGGTTCCTGAAAACCTCAAATTGGAGGAAACTACAGGAACCGCTCTGGTCACAA
GCCAAAGACCGAGAAGAGGAAACGCGAGAAAAGGGAAACAGAGACGAGACTTCCAAAGAGACATTCTCCCTGGACTTCTG
TCTCTTTCGAAACACGAAGTAACAGAAGACATTCAAATGTTTGATGGGTTCATGAGAGCAACAGGAAGATCTTGGACTCC
AACCGGTTTAACAAGGAAGAAAACCGGTTCAAGAGGAAGACCACGACGAGCCATAACAATCCCTGCTGAACCGGTCTATT
GTCCGGTTCCAGCTCCAGCTCCTCCTCCTCCCTCAGTTCAACAACATGTGAGCAATCAAAGCAACAATGGTGAAACTGAA
ATGTGTTTAGAAGATAGAAGCTTTGCAGGTTGGGGTAAGATGACAAGAAGGCCTAGAAGACAACGATGTCCTTCAGCTTC
AACTACAACTGCAACTACAAGTAACCAACGTTCATCATCACACGCGCCTTTCACGTGA