Details for Arabidopsis Locus AT1G13880

Position : Chr1 ( 5`- 4748873 .. 4751212 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G13880

Protein [Map View]
MGFKRTFDAEDVQELNVKNGRQISYCNKLAKLDEGVPYRLSLEKPGVVGYDISDLYGYKCEDNVDKGFETNAPFSWITTG
LSEEDSQSGATIQSTISHESPESDIPWRPVCSGEEDGYWCPISPRKTVPIGSDYQADIPECVKEEANDQSGQGVGYDEEQ
VTGKCVIPMPDCETEVCKIGKGRKECICLDKGSIRCVQQHIMENREDLFATIGYDRCLDIGLCEMGEEVAARLTEDEEDL
FHEIVYSNPVSMDRDFWKHLKSAFPSRTMKEIVSYYFNVFILRRRAIQNRSKSLDVDSDDDEWQVEYDNTFYGAETPSDD
KAEKSLSRDEGEEVNANEDSYMSFENQSNAIYSRCPVRNREESNIGNYWRHCNDLVDQSYSFDPCDSILPDHCWTKNIDL
LPTSNIIDEIFGQDHPWDDFSRGK*

DNA
ATGGGTTTCAAGCGAACGTTTGACGCTGAAGATGTTCAAGAGCTCAACGTTAAGAATGGAAGACAGATTAGTTACTGTAA
TAAGCTGGCCAAACTAGATGAAGGAGTTCCATATCGTCTTTCACTGGAGAAGCCAGGTGTCGTAGGATATGATATAAGTG
ATCTCTACGGGTATAAATGTGAGGATAACGTTGACAAGGGGTTTGAGACCAATGCGCCTTTCTCTTGGATCACAACTGGT
TTGTCTGAGGAGGATTCTCAGTCTGGAGCTACGATTCAGTCTACCATTTCTCATGAATCTCCTGAGTCAGATATACCTTG
GAGACCGGTTTGCTCTGGGGAAGAAGATGGCTATTGGTGTCCGATTTCTCCTAGAAAAACGGTTCCAATCGGGTCAGATT
ACCAGGCTGATATTCCTGAATGTGTCAAGGAAGAGGCAAATGATCAGTCGGGTCAAGGTGTTGGTTACGATGAAGAACAA
GTGACAGGGAAGTGCGTAATTCCAATGCCTGACTGTGAAACCGAGGTCTGCAAGATTGGTAAAGGAAGAAAGGAATGCAT
TTGCCTGGATAAAGGTTCCATCAGATGTGTACAGCAGCATATTATGGAAAACAGGGAAGATTTGTTTGCAACTATTGGGT
ACGACAGGTGTCTGGATATAGGTCTTTGTGAAATGGGGGAGGAAGTTGCTGCTAGACTAACTGAAGACGAGGAAGATCTG
TTTCATGAGATTGTTTACTCCAATCCGGTTTCAATGGACCGGGATTTCTGGAAACACCTAAAGTCTGCGTTTCCTTCACG
AACCATGAAGGAAATTGTGAGCTATTATTTCAATGTCTTTATCCTGCGAAGACGAGCTATCCAGAACCGTTCTAAAAGCC
TGGATGTTGATAGTGATGATGATGAGTGGCAAGTAGAGTATGACAACACCTTTTATGGTGCTGAAACTCCATCAGATGAC
AAAGCCGAAAAAAGCCTCTCAAGAGACGAAGGAGAAGAGGTTAATGCTAATGAAGATTCGTACATGTCCTTTGAGAATCA
GTCCAACGCAATCTACTCTCGATGTCCAGTTAGAAATAGAGAAGAATCCAACATTGGGAATTACTGGCGCCACTGCAATG
ATCTTGTGGATCAGTCGTATTCATTTGATCCTTGTGATTCAATACTGCCAGATCATTGTTGGACTAAGAACATTGATCTG
CTTCCAACTTCAAACATTATCGACGAAATCTTTGGTCAAGACCACCCATGGGATGATTTCTCCAGAGGGAAGTAA