Details for Arabidopsis Locus AT1G13830

Position : Chr1 ( 5`- 4739873 .. 4741038 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G13830

Protein [Map View]
MKVLLGLLLLLSLTNSSSAIYCLCKDGIGDTELQTSIDYACGTLADCNPIHDKGTCYQPDTIKSHCDWAVNSYFQNAAQV
PGSCNFSGTATTNPNPPSNLANGCIYPSSPSSTRSPPSTTPPTGTTPTNGTTPFPGTPFPGTPFPGTPPVFGPTGVFNPS
NPGSGASSLGTSSVFTLCFSLLAFLWGSDVRFGFSHV*

DNA
ATGAAAGTGCTTCTCGGTCTTTTGCTTCTCTTGTCCTTGACCAATTCTTCAAGTGCAATTTACTGTCTCTGTAAAGATGG
GATAGGAGACACAGAGCTTCAAACATCAATAGACTATGCATGTGGAACCTTAGCTGATTGTAATCCTATACATGATAAGG
GTACTTGTTATCAACCAGACACCATCAAAAGCCACTGTGATTGGGCTGTGAATAGCTACTTCCAAAACGCAGCTCAAGTC
CCTGGAAGCTGCAATTTCTCTGGCACTGCCACTACCAATCCAAACCCACCTTCCAATTTGGCTAATGGTTGCATCTATCC
GTCAAGCCCTAGCTCTACTAGGTCTCCTCCATCAACAACACCACCAACGGGAACAACTCCCACAAACGGAACCACTCCAT
TTCCGGGAACTCCATTTCCAGGAACACCGTTCCCGGGAACTCCTCCGGTGTTTGGTCCAACCGGAGTCTTCAACCCAAGC
AACCCAGGCAGTGGTGCTTCAAGTTTGGGCACCTCCTCTGTTTTCACACTCTGTTTTTCATTACTAGCCTTTCTATGGGG
CTCTGATGTAAGGTTCGGATTTAGCCACGTGTAG